KEGG   Vitis vinifera (wine grape): 100245923Help
Entry
100245923         CDS       T01084                                 

Definition
[Pyruvate dehydrogenase [lipoamide]] kinase, mitochondrial-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 369 aa AA seqDB search
MAVKKLCESYSKSFRGEVQRWGCMKQTGVSLRYMMEFGSRPTEKNLLISAQFLHKELPIR
IARRAIELESLPYGLSEKPAVLEVRDWYLDSYRDLRAFPEIKDKNDELEFTQMIKMIKVR
HNNVVPTMALGVQQLKKGINVKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNP
APDCVGYIHTKMSPVEVARSASEDARSICLREYGSAPDISIYGDPNFTFPYVPTHLHLMV
FELVKNSLRAVQEQFMDSDKVAPPVRIIVADGIEDVTIKVSDEGGGIPRSGLPKIFTYLY
STAKNPLDEQSDIGSSGGLTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSR
LGDSQEPLP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcggttaagaaactgtgcgagtcctactcaaagagtttcagaggtgaggtacagaga
tggggttgtatgaagcagactggtgtgagtttgaggtacatgatggagtttgggtccaga
cccactgagaaaaatctgcttatctctgctcaatttcttcacaaagaactccccataaga
atcgccaggagagccattgagctcgagagcctaccctatggcttatctgaaaagcctgct
gttttggaggtgagggactggtatttggactcttaccgtgaccttcgggcctttccggag
atcaaggataaaaatgatgaattggaattcacgcaaatgattaagatgattaaagtgaga
cacaacaatgtggttcccacaatggctttgggtgttcaacagttgaagaaaggcattaat
gtgaagattgtttatgaggatctggatgagattcatcaatttttagatcgtttctacatg
tcaaggattggaattcgcatgcttattgggcagcacgtagagctgcataatccaaaccca
gctccagattgtgtgggttatatacacacaaaaatgtctcctgtggaggtagcacgaagt
gccagtgaggatgcccgctctatttgcttacgagagtatggcagtgcaccggatattagt
atatatggggatcccaattttacattcccttatgttccaacacacttgcatctcatggta
tttgagttggttaaaaactccttgcgtgctgtccaagagcagtttatggactctgacaaa
gttgcacctcctgttcgaataatagttgctgatggaatagaggatgttactattaaggtc
tcagatgaagggggtggaatcccaagaagtggcctccctaaaatctttacatatctttat
agtactgcaaagaacccgctggatgagcagtcagatattgggtcatctggtgggttaaca
atggctggatatggatatgggcttccaatcagtcgcttatatgcgcgatattttggcggg
gatctgcaaattatctccatggagggatatgggactgacgcatatctgcatctgtctcga
ttgggggattcacaagaacccctcccatga

DBGET integrated database retrieval system