KEGG   Vitis vinifera (wine grape): 100246445Help
Entry
100246445         CDS       T01084                                 

Definition
acyl-protein thioesterase 2-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100246445
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100246445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 257 aa AA seqDB search
MSYSNHSMGSGSRTARRTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLENLPLP
NIKWICPTAPTRPVAVLGGFPCTAWFDVGELSDDGPDDLDGLDASAAHIANLLSTEPADV
KLGVGGFSMGAATALYSATCYAQAKYGNNSPYPVNLKAVVGLSGWLPGSRSLRNKIEGSH
EAARRAASLPIMLCHGMNDDVVAYNYGERSAHCLSSAGFRYLTFKAYDGLGHYTVPKEMD
EVCTWLTARLGLEGCHS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagctactctaatcattctatgggttctggtagtagaactgcaagaaggacctttgag
tttggaaggacacatgtggtgaggcccaagggaaaacaccaggccacaatagtttggcta
catggccttggtgacaatggctcaagttggtcccagctcttggaaaaccttccacttcca
aatataaaatggatttgtccaactgctcctactcgtcctgttgcagtactcggtggattt
ccttgcactgcatggtttgatgtgggagagctttcagatgatggtccagacgatttggat
ggtttagatgcatcagcagcacacattgcaaacttgttgtcaactgaacctgctgatgtt
aaacttggtgtcgggggcttcagtatgggtgctgcaactgccctctactctgccacttgt
tatgcacaggcgaaatacggaaataacagcccataccctgtcaatttaaaggcagttgtt
ggcttaagtggctggcttccaggttcaaggagcttgaggaataagatagaaggatcacat
gaggctgcaaggcgtgctgcatcgttgccaattatgctctgtcatggaatgaatgatgat
gtagtggcctataattatggagagagatccgcccactgcttaagttctgctggatttcga
tatcttacattcaaagcctatgatggacttggtcattatacagttcccaaagagatggat
gaggtctgcacttggctaactgcaaggctggggcttgaggggtgccactcataa

DBGET integrated database retrieval system