KEGG   Vitis vinifera (wine grape): 100246727Help
Entry
100246727         CDS       T01084                                 

Definition
uncharacterized LOC100246727
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100246727
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   100246727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 528 aa AA seqDB search
MTRILVQRGSGSNPNRTSSLPSSSLAPSQPQAATQVPSTVKDEEVGEEVQEQTIVDDTLE
TCENKVTKTDDLLQESVRNDNANDDNVDGEKIVNDDVLGSGDLDQEFGGLRINEKLAVEN
EGSSADSSQIVNRSSYPPPPPVPPPKHWATNSNPMRFGSDGSNSVRIGSPRRAVAWPIVS
TRTSPTGSRPSSPRSHGESEGYNSADEQNSCFVSSYDDAERERQFEIDIRRAKGLEVKRM
VEDGNCLFRAVADQVYGDSEAYDLIRQMCIDYMERERDHFSQFITEGFMSYCKRKRRDKV
YGNNAEIQALSEMYNRPIHIYSYSTEPINIFHGSYDTDTPPIRLSYHHGNHYNSLVDPRR
LTIGAGLGFSSLRGVNVDKDQVKAAIKAQQDQQIDNALLAEGRFYSDLELTEKEIERMVM
EASRAEYLADDKFKSQLGCRESSSTSGAEPSSSGARPSGSETKLEGGREQHGLPDTVLSS
SMQMVLSMGFSYLQVIEAYSIFGDDAESMACYLVETGSSSRRKGKATE
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgactcggattttggttcagcgtggttctggttcgaaccctaatcgcacttcttccttg
cccagttcttctttggctccatcccagcctcaggccgctactcaagttccttctactgtc
aaagatgaggaagtcggagaggaggtgcaggaacaaacaatcgtggatgataccttggag
acttgtgagaataaggtgacgaaaactgatgatcttttgcaagaaagtgtccggaatgac
aatgcaaatgatgataatgttgatggtgaaaagattgttaatgatgatgttctggggtct
ggggatttggatcaagagtttggtgggttgaggattaatgagaaacttgcagttgaaaat
gagggctcgagtgctgattcttcacagattgttaacaggagttcctatccccctcctcct
cctgtccctcccccaaaacattgggcgactaattcaaatccaatgagatttggctcagac
ggttcaaattctgtacggattggatcacctagaagagcagttgcctggcctattgtttca
actaggacttctccaactggttcacggccttcctctcccaggtctcatggtgaaagtgaa
ggttacaatagtgctgatgagcagaattcctgctttgtatcctcctatgatgatgctgaa
agagaacgccaatttgagattgatatcaggcgggcaaaaggtttagaagtcaaacggatg
gtggaggatgggaactgcctctttcgtgctgttgcagatcaggtctatggggactctgaa
gcgtatgatttgattaggcaaatgtgcattgattatatggagcgggagagagatcacttt
tctcaattcataacagaaggttttatgtcttactgtaagaggaagagaagagacaaggtc
tatggaaacaatgcagagatccaagctttatctgaaatgtataatcggcctatccatata
tattcctatagcacagaacctatcaacatttttcatggaagctatgatactgacacacct
cccattcgattaagctatcatcatgggaatcattacaactcacttgttgatccccggcga
ttaaccattggtgctgggcttggatttagctctctacgtggggtgaatgttgacaaggat
caagtcaaggctgctattaaagctcaacaagaccaacaaattgataatgcacttctagct
gaggggcggttttactcggatcttgagctcacggagaaggagattgaacgtatggtgatg
gaagcctctcgagctgagtatcttgctgatgacaaattcaagtcacaacttggctgtaga
gagtcttcttctacgtctggtgctgaaccatcgtcttctggagcaaggccatcagggagt
gagacgaagctggaagggggaagggagcagcatgggttaccagatactgtcctcagcagt
agcatgcagatggttctgtcaatggggttcagctatctgcaggtgattgaagcttacagc
atatttggggacgatgctgaatctatggcttgttacctggtggaaactgggagtagcagc
agacgcaaaggcaaggcaactgaatga

DBGET integrated database retrieval system