KEGG   Vitis vinifera (wine grape): 100246795Help
Entry
100246795         CDS       T01084                                 

Definition
probable pectinesterase/pectinesterase inhibitor 59-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:vvi00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vvi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 523 aa AA seqDB search
LLKNNSFLSKEIILIRIHVLSQSKNGCGNIKWWCNTTPHPEPCKYFMSHSHQRFAPDHKS
DFRRMLVQVAMDRALHGQRQVLRSGSNCVNKWQKGALNDCLKLYEDTVYQLNQTLQGLHG
NQSCSDFDAQTWLSTAFTNLETCQDSAKDLNVTNFIFPLMSNNVSELISNSLAINDGLME
GTSYRGGFPSWVSAGERKLLQSTSLATSANLVVAKDGSGDFSSIQAAINAAAKRTSSGRF
IIYVKKGLYRENIEVGINVNNITLVGDGMKKTIITGSRSVRGGYTTYNSATAGIQGLRFI
ARGITFKNTAGPKNGQAVALRSSSDLSVFYHCAFQGYQDTLMVHSQRQFYRECYIYGTID
FIFGNAAVVFQQCMIFARRPLQGQANVITAQGRGDPYQNTGISIHNSRILAASDLKPVVG
SFKTYLGRPWQQYSRTVILKTYLDSLVDPSGWSPWGTSNFAQSTLYYGEYQNFGPSSSTR
NRVKWSGYHVITSATVASRFTVGSFIAGQSWLPATGVPFTSGL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
ttgcttaagaacaactcctttttatctaaagaaattatcttaattaggatacatgtgctt
tcccaatcgaaaaatggttgtggcaacataaaatggtggtgcaacaccacgccgcatcct
gagccctgcaagtatttcatgagccatagccaccaacgttttgcacccgatcataagtcc
gattttcggaggatgttggtgcaagtagccatggatcgagcccttcatgggcagaggcag
gtgctgcggtccggctccaattgtgtgaacaagtggcagaaaggcgctttgaatgactgt
ttgaagctctatgaggacaccgtgtaccagctaaatcaaactcttcaaggcctacatggt
aaccaaagttgtagcgattttgatgctcaaacatggcttagcaccgcctttacgaatcta
gaaacttgtcaagacagcgccaaggatcttaacgtcacaaacttcatattccccctcatg
tccaacaatgtttctgagctcatcagcaacagcttggctataaatgatggacttatggag
ggaaccagttatagagggggatttcctagctgggtttcggctggtgagaggaagttgttg
cagtctacgtcgcttgctacaagtgcaaatcttgtagtagcgaaggatggctcgggagat
tttagctccattcaagctgctataaatgcagcagcgaagaggacaagcagtgggaggttc
attatatatgtgaaaaagggtctttatagggagaatattgaagttggcatcaatgtaaac
aatattacgctggttggtgatggcatgaagaaaacaatcatcactggcagcaggagtgtt
agaggaggctacaccacctacaactctgcaactgctggaatccaaggtcttcgctttatc
gcacgaggcattacattcaagaacacagccggtccaaaaaatggccaagcagttgcactc
agatcaagttctgatctctcggtcttctaccactgtgccttccaagggtaccaagatacc
ctcatggtccactcccaacggcaattctatagagaatgctacatctatggcaccatagac
ttcatatttggaaacgcagcagtagttttccaacagtgcatgatctttgctagaaggccc
ctacaaggccaagccaacgtgatcacagctcagggccggggcgatccataccaaaacact
ggaatatccatccataattctcgaattcttgctgcatctgacctaaagccagtggttgga
tcattcaaaacatacttgggaaggccatggcagcaatattcacgaaccgttatcctcaaa
acttaccttgatagcttggttgatccatcagggtggtcaccatggggcacttctaatttt
gctcagagtacattgtattatggtgaatatcagaattttggaccttcttcatcaaccaga
aatagggtgaagtggtctggttatcatgttattactagtgcaaccgtggcatcgcggttc
accgtcggcagcttcattgctggccagtcatggctgccggccaccggtgtgcccttcact
tccgggctctga

DBGET integrated database retrieval system