KEGG   Vitis vinifera (wine grape): 100246880Help
Entry
100246880         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 23-like
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 955 aa AA seqDB search
MAEALISNPEANTQENGPYSASPDPSSTGSFFHRRIEFHLARKPFSGFTNGGGGFRLETL
NPTTDPKRPGHSTGPAASSGKKQDGSDHVENGLDPELSIGITFRRIGAGLENLGNTCYLN
SVLQCLTYTEPLAAYLQSGKHQNSCRIAGFCALCAIQKHVSRALQSTGRILVPKDLVSNL
RCISRNFRNARQEDAHEYMVHLLETMHKCCLPSGVPSESPSAYEKSLVHKIFGGLLRSQV
KCMQCSYCSNKFDPFLDLSLEIFKADSLHKALVHFTATEQLDGGERQYQCQRCKQKVKAL
KQLTVHKAPYVLTIHLKRFGAHDPGQKIDKKVHFGPTMDLKPFVSGSYEENLKYTLYGVL
VHAGWSTHSGHYYCFVRTSTGMWYSLDDNRVVQVSERTVLDQKAYMLFYVRDRKNFTPKK
SIDVVQKQNLVVSAIAKKTCSSISQGIKETIQNRPVEKSLSGAIASAAVTTNDVSNVGLS
KEILSKEASAPKSSRFSSECLALKNGPMSEPPPNVALSKQRVKEPSVLNPTLEKSMPPSA
PSVKGSGITNLDNAVAASTGAKFNVRSEDEISKKDQGILDVIQANCLGSHNSAADKPDSE
KTSPKAIGNSIPFAVGIISNANGTLEKIEPVKFPNGPGGESFQVGSIPKGSAAGDLLIEN
VDDGGQKLSTKSVEFSSPPSMMNGSIHMKTLDCKPHRKLKKKHMKRSMHLVSNNLFRASL
SLRKKKKQRRSKRHTSDIKNLTQERLLEAGCLSIDQGPSTSDKTQTISVGPTNPQGKRVK
HGTKKGDKRTAGKDVKTSNSECLMDTMDMEIRDRIGQEGAMLATDKEPQKSSSSVAKQWD
AQGSDSLNDSKRDRMQNGLMSMLTRGLDKTIVARWDEIEWPSNRVMESRSVEGVTIGYVP
DEWDEEYDRGKRKKVRSSKGSFGEPNPFQEIATKKAHFKKAKMDRSSSRNQPLRM
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgctgatctccaacccggaagccaatactcaggaaaatggtccctactcg
gcttcgccggacccgtcttcaactgggtccttcttccacagaagaatcgagtttcatctc
gcaagaaagcctttctccggcttcactaacggcggcggaggttttcgactagagactctg
aaccccaccaccgatccgaagcggcccgggcacagtacgggtccggcggcttcgagtggg
aagaagcaagatgggtctgatcatgtggagaacgggttggatccggagctcagtattggg
atcacatttaggagaattggtgctggtttggaaaatctgggaaatacctgttatcttaat
tcagtattgcaatgcctgacttatacagagcctttagcagcatatttgcaaagtggaaag
catcaaaattcttgtcgtattgctggattttgtgctttatgtgctatccagaagcatgtc
agccgtgctcttcagtcaactggaagaatattagtacccaaggatcttgtctctaactta
cggtgcatatctcgtaacttcagaaatgcaagacaggaggatgcacatgagtatatggta
catttgcttgaaacaatgcacaaatgttgcttaccttcaggtgtgccaagtgaatcccct
agtgcttatgagaaaagtttggtgcacaagatctttggtggtctccttcgtagtcaggtg
aaatgcatgcagtgctcctactgctccaacaaatttgatccatttctagatttgagtctt
gaaatattcaaagcagattccttgcataaggcccttgtgcacttcacagcaacagaacaa
ttagatggtggtgagagacagtaccaatgtcagcggtgcaaacagaaagttaaggctctt
aaacagctcacagttcacaaggcaccttatgttctgaccatccatctaaagcggtttggt
gcacatgatcctggacaaaagattgacaagaaagttcattttggtcctacaatggactta
aaaccttttgtcagtggttcctatgaagaaaatttgaagtatactctttatggggttttg
gtccatgccggttggagcacccattccggccactactactgctttgttcgcacttcaact
ggcatgtggtactcccttgatgacaatcgggttgtccaggttagtgagaggactgttttg
gatcagaaggcctacatgttgttttatgttcgtgatagaaaaaacttcactccaaagaaa
tccattgatgttgttcagaaacaaaacttggttgtgagtgccatagcaaagaaaacatgt
tccagtataagtcaaggtataaaggaaaccattcaaaatcgaccagtcgagaaaagttta
agtggtgccattgcttctgctgctgtaaccacaaatgatgtatctaatgttggcttgtca
aaggagattctatcaaaagaagcatcagctccaaaaagtagcaggttctcatctgaatgc
ttggcattgaaaaatggtcccatgtctgaacctccacctaatgtagcattatcaaaacag
cgagtgaaggagccttctgttctgaaccctactctggagaaatccatgccaccatcagct
ccatctgttaagggaagtggtatcaccaatcttgacaatgctgttgcagcttcaactggt
gccaaatttaatgtgcgcagtgaggatgaaatttctaagaaagatcagggcatcttagat
gtcatacaagccaactgcctcggttcccataattctgctgccgataagcctgactcagag
aagacctctccgaaggcaattggaaattccattccctttgcggttggtattatttcaaat
gcaaatggaacattggagaaaatagaacctgttaagtttccaaatggtccaggtggtgaa
agttttcaggttggtagtatacccaaagggagtgctgctggtgatttacttattgaaaac
gttgatgatggtggccagaaattatcaaccaagtcagtagaattttctagcccgccaagc
atgatgaatggatctatccacatgaaaacacttgattgcaagcctcacagaaaactaaaa
aagaagcacatgaagagaagcatgcatcttgtctcaaacaacctcttccgagcatccttg
agcctgcgaaagaagaaaaagcagagaaggagcaaacggcacacttctgacatcaagaat
ctcactcaagaacgcttactggaagcaggttgtttatctattgatcagggcccatccaca
tctgataaaacccagacaatttctgtgggtccaactaatcctcagggaaaaagggttaag
catggtaccaaaaagggagataagagaactgctgggaaggatgtaaaaacctctaatagt
gaatgtctgatggataccatggatatggagatcagagacagaattggtcaggagggagca
atgcttgcaacagataaagaaccacaaaagagctctagctcagttgcaaaacagtgggat
gcacaaggttctgatagtttaaatgatagtaagagagatcggatgcagaatggattgatg
agtatgcttaccagaggtctagacaagacaattgttgctcggtgggacgagatagaatgg
ccttcaaaccgggttatggaatcaagaagtgtggagggtgtaaccatcggttatgtacca
gatgaatgggacgaagaatatgatcggggcaagagaaagaaagtaaggagctccaaaggt
agctttggtgaacctaatccttttcaagaaattgcgaccaagaaggcacattttaaaaag
gcaaagatggatcggtccagctccagaaaccaaccactcaggatgtga

DBGET integrated database retrieval system