KEGG   Vitis vinifera (wine grape): 100246890Help
Entry
100246890         CDS       T01084                                 

Definition
putative pectinesterase 11-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100246890
   00500 Starch and sucrose metabolism
    100246890
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     100246890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 318 aa AA seqDB search
MASSATSSNDMSTAILIRVDQSGNGDYGKIQDAIDAVPSNNSQLYFILVKPGTYREKIVV
PADKPFITLSGTQASTTIITWGDGGEIFESPTLSILASDFVGRYLTIQNTFGTSSKAVAV
RVSGDRAAFYNCRILSYQDTLLDDAGRHYYRNCYIEGATDFICGSAASLFEKCHLHSLSE
GNGAITAQQRGSTSENNGFTFLGCKITGVGTPYLGRPWGPYSRVVFVLSFMSSVVQPQGW
DDWGDSNKQSTVYYGEYKCYGPGANRTERVEWSRSLSSDEAVPFLTKEMIGGQGWLRPAP
TYFMRGSSVITMNTDGKN
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccgccacaagctcgaatgacatgtctactgccattctcataagggttgac
cagtctggaaatggagattatggcaagattcaagacgccattgatgctgttccatctaat
aactcacagctttatttcatcttggtcaagccaggaacatacagagaaaagattgttgtg
cctgctgacaagcccttcataacattgagtggcacacaggcctctactaccataataaca
tggggtgatggaggggagatatttgagtctccaacactctccatattggcttctgatttt
gttggaagatatctcacaattcagaatacatttgggacaagcagcaaagctgttgcagta
agggtatcgggcgacagagctgcattctacaactgcaggatcctgtcttatcaggacact
ctcctggatgatgctggaagacattactacagaaactgctacattgaaggagccactgat
ttcatctgtggaagtgctgcttctctctttgaaaagtgtcacctgcattcactctctgaa
ggaaatggagccatcactgcccaacaaagagggtctacttcagagaacaatggctttacc
ttcttgggctgcaagatcacaggcgttggaactccttaccttggaaggccatggggtcct
tactctagggtggtgtttgttctatccttcatgtccagtgtggtacagccacagggatgg
gatgactggggagactccaacaagcaaagcacagtatactatggcgaatacaagtgttat
ggtcctggtgccaatagaacggaaagagttgaatggtcgcggagcctatcaagcgatgaa
gccgtacccttcctgacgaaggagatgataggagggcagggctggcttagacctgcacca
acctacttcatgagaggctctagtgttatcaccatgaatactgatggaaaaaactag

DBGET integrated database retrieval system