KEGG   Vitis vinifera (wine grape): 100247177Help
Entry
100247177         CDS       T01084                                 

Definition
probable MYST-like histone acetyltransferase 1
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100247177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 439 aa AA seqDB search
MGSIDAPTFTQNGSDATVAADGPPPPVPDSAIMTMEKTLEADSSRKRRFGILPLEVGTRV
MCRWRDGKYHPVKVIERRKMHIGGVNDYEYYVHYTEFNRRLDEWVKLEQLDLESVEAVVD
EKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIET
WYFSPFPPEYNDSLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEV
DGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEES
YNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLD
ILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAAGR
GGLEVDVSKLIWTPYKEQG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgatagacgcaccgacgtttacacagaacggctcggacgcaactgtcgccgcc
gatggaccaccgccgcctgtacctgattccgccatcatgacaatggaaaagacactagag
gctgactcatccaggaagaggaggttcggtattcttcctctggaggtgggcactcgcgtc
atgtgccgttggagggacggaaaatatcatcccgtcaaggtcattgaacgccgtaaaatg
catatcggcggtgtcaatgattacgagtattatgttcattacacggaattcaataggagg
cttgatgaatgggttaagcttgaacaacttgatcttgaatccgtagaggctgttgttgat
gaaaaggtggaggacaaggtaactagcttgaaaatgacacgccatcagaagcgtaagatt
gatgagacacatgtagagggccatgaagagcttgatgctgccagcttgcgtgagcatgaa
gaatttacaaaagtgaaaaatatagcaactatagaacttgggagatatgaaatcgaaaca
tggtatttctctccctttccaccagaatacaatgactctctgaagctgtacttctgtgag
ttttgcctcaatttcatgaagcggaaagaacagcttcagaggcatatgaggaaatgtgat
ctcaagcatccccctggagatgagatataccgaagtggcacattatcaatgtttgaggtt
gatggcaaaaagaacaaggtttatgggcagaacctctgttatttggcaaaattgtttctt
gatcacaagaccctctattatgacgttgacctgtttctattttatgtgctgtgtgaatgt
gatgatcgtggatgccacatggtcggatatttttctaaggaaaagcattcagaggaatcc
tataatttagcctgcattctcacccttcctccatatcaaaggaaaggttacgggaaattc
ctaattgcattctcatatgaactttccaagaaagaaggcaaagtcggtacacctgaaaga
cccctttctgacttagggctgttgagctatcggggatactggacccgtgtccttctagac
atcttgaaaaaacacaagggcaatatttctatcaaggagctcagtgacatgacagccatt
aaggcagaggatatattgactactcttcaaagcctagaattgattcagtaccggaaaggc
cagcatgtcatctgtgctgatcccaaggtcttagatcggcatctgaaagctgctggccgg
ggtggtttagaggttgatgttagcaaattgatctggactccttacaaagaacaaggttga

DBGET integrated database retrieval system