KEGG   Vitis vinifera (wine grape): 100247288Help
Entry
100247288         CDS       T01084                                 

Definition
acetyl-CoA carboxylase 1-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:vvi01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vvi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vvi00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:vvi00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 2257 aa AA seqDB search
MAGLGRGNGLIDGVTLRTPSTSSQIDEFCRALGGTRPIHSILISNNGMAAVKFIRSVRTW
AYETFGTEKAISLVAMATPEDMRINAEHIRMADQFVEVPGGTNNNNYANVQLIVEMAEIT
HVDAVWPGWGHASENPELPDALNAKGIVFLGPPATSMGALGDKIGSSLIAQAADVPTLPW
SGSHVRIPSESCLVTIPDEVYREACVYTTEEAIASCQVVGYPAMIKASWGGGGKGIRKVH
NDDEVKALFKQVQGEVPGSPIFTMKVASQSRHLEVQLLCDQHGNVAALHSRDCSVQRRHQ
KIIEEGPITVAPHETVKKLEQAARRLAKCVNYVGAATVEYLYSMETGEYYFLELNPRLQV
EHPVTEWIAEVNLPAAQVAVGMGIPLWQIPEIRRFYGMEHGGGYDAWRRTSVVATPFDFD
KAESIRPKGHCVAVRVTSEDPDDGFKPTSGKVQELSFKSKPNVWAYFSVKSGGGIHEFSD
SQFGHVFAFGESRALAIATMVLGLKEIQIRGEIRSNVDYTIDLLHASDYRENKIHTGWLD
SRIAMRVRAERPPWYLSVVGGALYKASASSAAMVSDYVGYLEKGQIPPKHISLVNSQVSL
NIEGSKYTIDMVRGGPGSYRLRMNESEIESEIHTLRDGGLLMQLDGNSHIIYAEEEAAGT
RLLIGGRTCLLQNDHDPSKLVAETPCKLLRYLISDNSHVDADTPYAEVEVMKMCMPLLSP
ASGIIQFKMSEGQAMQAGELIARLDLDDPSAVRKAEPFHGSFPILGPPTVISGKVHQRCA
ASINAARMILAGYDHNIDEVVQNLLSCLDSPELPFLQWQECLAVLATRLPKDLRNELESK
YKEFEGISSSQNVEFPAKLLRGVLDAHLCSCPDKEKGAQERLVEPLMSLVKSYEGGRESH
ARIIVQSLFEEYLSIEELFSDNIQADVIERLRLQYKKDLLKIVDIVLSHQGVRSKNKLIL
RLMEQLVYPNPAAYRDKLIRFSALNHTSYSELALKASQLLEQTKLSELRSSIARSLSELE
MFTEEGENMDTPRRKSAINERMEALVSAPLAVEDALVGLFDHSDHTLQRRVVETYVRRLY
QPYLVKGSVRMQWHRSGLIASWEFLEEHLERKNASEDQISDKSLIEKHNEKKWGAMVIIK
SLQFLPTVISAALRETTHHFEESIPSGSIEQDSHGNMMHIALVGINNQMSLLQDSGDEDQ
AQERINKLARILKEQEVSSSLRAAGVGVISCIIQRDEGRAPMRHSFHWSVEKLYYEEEPL
LRHLEPPLSIYLELDKLKGYENIKYTPSRDRQWHLYTVVDKQLPIQRMFLRTLVRQPTSE
GLTLYQGLDVGTTQTQSTMSFTSKSILRSLMTAMEELELHGHNATVKSDHSHMYLYILQE
QQIDDLVPYPKRVVIGAGQEEAGVERILEELAHEIHASVGVRMHRLGVCEWEVKLCIASA
GQAYGSWRVVVANVTGHTCTVHIYRELEDASKHRVVYHSKSAQGHLQGVPVNAHYQHLGV
LDRKRLLARRSNTTYCYDFPLAFETALQQLWASQSQGINRPNDKVLFKVTELAFADKRGS
WGTHLVPVERTPGENDVGMVAWRMEMSTPEFPNGRTILIVANDVTFKAGSFGPREDAFFL
AVTDLACSEKLPLIYLAANSGARIGVAEEVKACFKIGWSDESSPERGFQYVYLTPEDYAR
IGSSVIAHELSMESGETRWVIDTIVGKEDGLGVENLTGSGAIAGAYSRAYKETFTLTYVT
GRTVGIGAYLARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPKIMATNGVV
HLTVSDDLEGVSAILKWLSYVPSHVGGALPILKPSDPPERPVEYFPENSCDPRAAICGAP
NSSGKWLGGLFDKDSFVETLEGWARTVVTGRAKLGGIPVGIVAVETQTVMQVIPADPGQL
DSHERVVPQAGQVWFPDSATKTSQALLDFNREELPLFILANWRGFSGGQRDLFEGILQAG
STIVENLRTYKQPVFVYIPMMGELRGGAWVVVDSRINSDHIEMYAERTAKGNVLEPEGMI
EIKFRTKELLECMGRLDQQLINLKAKLQEAKSSRVHGTVESLQQQIKAREKQLLPVYTQI
ATRFAELHDTSLRMAAKGVIKEVVDWGNSRSFFYRRLHRRVIEGSLIKVVRDAAGDQMSH
KCAMDLIKKWFLDSEIASGSKDAWADDQAFFTWKNDPANYEEKLQELRAQKVLLHLSKIG
DSASDLQSLPQGLAALLQKVEPSSRAQLIGELRKVLN
NT seq 6774 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcttggccgggggaatggtttaatagatggagtaacactaaggaccccatct
acatcatctcaaattgatgaattctgccgggctcttggtgggacaaggccaatacatagc
attttaatttcaaacaatggaatggctgctgtcaagtttatccgcagtgtcaggacatgg
gcatacgaaacatttggtactgagaaggcaatctcattggtggccatggctactcctgag
gacatgagaataaatgctgagcatattagaatggctgatcagtttgtggaagttcctggt
gggactaacaataataactatgccaatgtgcaactcattgtagagatggcagagataaca
catgttgatgcagtttggcctggttggggccatgcatctgagaaccctgagctgccagat
gctctgaatgctaaggggattgtatttcttggaccccctgcaacatctatgggggcactt
ggagataagattggttcatcattgattgctcaagcagcagatgtacccacccttccatgg
agtggttcacatgttaggattccttctgaaagttgcttggttactatcccagatgaagtg
tatcgggaggcatgtgtttatactacagaggaagcaattgctagttgtcaggttgtgggt
taccctgccatgatcaaggcatcttggggtggaggtggcaaaggcataagaaaggttcat
aatgatgatgaagtcaaggctttgttcaagcaagttcaaggtgaagttcctggctccccc
atattcacgatgaaggttgcttcccagagtcgccatttagaagttcagttactatgtgat
cagcatggcaatgttgcagccctgcatagccgtgattgcagtgttcaaaggcgtcatcaa
aagattatcgaggaaggtccaattactgtagctcctcacgagactgtgaaaaagctggag
caggcagcgagaaggttagccaaatgtgtgaattatgttggagcagctactgttgagtat
ttgtacagtatggaaactggcgagtactatttcctagagctcaatcctcgattacaggtg
gagcaccctgtcacggagtggatagcagaagtaaatctgccagcagcccaagttgcagta
ggaatggggattcctctctggcaaattcctgaaataaggagattctatggaatggaacat
ggcggaggatatgatgcttggaggagaacatcagttgttgctaccccttttgattttgac
aaagcagagtctataagaccaaaaggccactgtgtggctgtccgtgtaacaagtgaggac
ccagatgatggttttaagcccactagcgggaaagtacaggagctgagttttaaaagcaag
ccaaatgtgtgggcatacttctctgttaagtctggaggagggattcacgagttctcagat
tctcaatttggacatgtttttgcatttggagaatccagagccttagctattgcaactatg
gttcttggattgaaggaaattcaaattcgaggagaaattcgttcaaatgttgattacaca
atagatcttttacatgcttctgattacagagagaataaaatccacaccggttggttggac
agtagaattgctatgagggttagagcagaaaggccgccttggtatctttctgtggttgga
ggggctctttacaaagcatctgctagcagtgcagcaatggtttcagattatgtcggttat
cttgaaaaggggcaaatccctcccaagcatatatctcttgtcaactctcaagtttctttg
aacatcgaaggaagcaagtacacaattgacatggtaaggggaggaccaggaagctataga
ctcaggatgaatgagtcggagatagaatcagagatacacacattacgtgatggtggttta
ttgatgcagttggatggaaacagtcatattatctatgccgaggaagaagcagctggaact
cgccttctcattggtggaaggacttgcttgcttcagaatgatcatgatccatctaagtta
gtcgcagagacaccatgcaagctgctacggtacttaatctcggataatagtcatgttgat
gctgacacaccgtatgcagaggttgaggttatgaagatgtgtatgccacttctttcgcct
gcttctggaattattcaatttaagatgtctgaaggtcaagcaatgcaggctggtgagctt
atagcaagacttgatctagatgatccttctgctgtaaggaaagcagagcctttccatggg
agctttccaattttagggcctcccactgttatttctgggaaagttcatcagagatgtgcg
gcaagcataaatgcagctcggatgatccttgcaggctacgatcacaatattgatgaagtg
gtgcaaaacttgttgagttgtcttgatagtcctgaactccctttccttcagtggcaagag
tgcttggctgttttggcaacccgccttcccaaagatctccgaaatgaattggaatcaaaa
tataaggagtttgaagggatatcgagctcccagaatgttgagttccctgccaaattgttg
cggggtgttcttgatgcgcatctatgctcctgtcctgataaagaaaaaggagcccaagaa
agacttgttgagcctttgatgagtcttgtgaagtcctatgaaggtggaagagagagtcat
gcccgcattattgtccagtctctctttgaagagtacctatctattgaagaactatttagc
gataacatccaggcagatgtaattgaacgccttcgacttcaatataagaaagatcttctg
aagattgtggacattgtgctttctcatcagggtgtcaggagtaaaaataagctgatatta
cgtctcatggaacaattggtttaccctaaccctgctgcatatagagataaactaattcgc
ttctctgcacttaaccatacaagctattctgagttggcactaaaggcaagtcaactactg
gaacaaaccaaactgagtgaacttcgttccagcattgcaagaagcctttctgaattagag
atgtttactgaagagggtgagaatatggatacaccaaggaggaaaagtgccatcaatgaa
cgaatggaggctcttgtgagtgctcctctagcagttgaagatgcccttgtaggtttgttt
gatcacagtgatcacacccttcaaaggcgtgttgtggagacttacgtccgccgactatac
cagccctacctcgtaaaagggagtgttaggatgcaatggcaccgatctggtttgattgct
tcctgggaattcttggaagagcatcttgagagaaagaatgcatcagaagatcaaatttct
gacaaatcattaatcgagaaacataatgagaagaaatggggggccatggttataatcaag
tctcttcagtttttgcctactgtaattagtgctgcattgagggaaacaactcatcacttt
gaagaatcaattccaagtggatctatagaacaagatagccatggtaacatgatgcatatt
gcattggtgggcatcaacaaccagatgagtttgcttcaggatagtggtgatgaggatcag
gctcaagagagaataaacaagttagccaggatacttaaggagcaagaagtaagctccagt
ctccgtgctgcaggtgttggagtaattagctgtatcatacagagggatgaagggcgagct
cccatgaggcactcctttcattggtcagtggagaagctttattatgaggaagagcctctt
ctgcgtcacctggaaccacctctatccatttaccttgaattggacaagctgaaaggctat
gagaatataaagtatactccatcaagggaccgtcagtggcacctatacactgttgtagac
aagcaattaccaatccagaggatgtttctcagaacacttgtaaggcaacccacaagcgaa
ggattaactttgtaccaggggctggatgtgggaacaacccaaacccaatcgactatgtct
tttacttctaagagcattttaagatccttaatgactgcaatggaggaattggaacttcat
ggacacaatgctactgtcaaatctgaccattcccacatgtacctttacattttacaggag
caacaaatagatgatcttgtgccataccctaagagagttgtcataggtgctgggcaggaa
gaagctggagttgaaaggatcctggaagagctggcacatgaaattcatgcatctgttggt
gtaagaatgcatcggttaggtgtctgtgagtgggaagtgaagctttgtatagcatctgct
ggacaggcctatggttcttggagagtggttgttgcaaatgtgactggtcacacctgcact
gtgcatatataccgagaattggaagatgccagcaaacacagagtggtctaccattcaaaa
tctgcccaaggtcatttgcaaggtgtaccagtaaatgcacactatcagcacttgggagta
cttgatcggaagcgtctgttggccaggagaagcaacactacgtactgctacgatttccca
ctggcatttgagacagccttgcaacagttatgggcatcccagtcccagggcattaacaga
cccaatgataaagttcttttcaaagtcacagagcttgcatttgctgacaaaagaggtagc
tggggtactcatctggttccggtggagcgcacacctggagaaaatgatgttggaatggta
gcctggcgtatggaaatgtctactcccgagttcccaaatggaaggacaattttgatagta
gcaaatgacgtaaccttcaaagctgggtcttttggcccaagagaggatgcattcttcctt
gcagtgactgatcttgcttgctctgagaaactgcccctaatttatttggcagcaaactct
ggagctcgtattggtgtagctgaggaagtgaaagcctgctttaagattggttggtctgat
gaatcaagtcctgagcgtggtttccagtatgtatatttgactcctgaggactatgcacgc
attgggtcatctgtgatagctcacgagttaagtatggaaagtggagaaaccagatgggtt
atagataccatagtcgggaaggaggatggtttgggggttgagaacttaacgggtagtgga
gccattgctggtgcatattcaagagcatataaggaaacctttactttaacttatgtgaca
ggcaggactgttggaataggcgcttatcttgctcggctcgggatgcggtgcatacagagg
ctcgatcagcctataattttgactggtttctctgcattaaacaaacttcttggtcgggag
gtgtatagttcccacatgcaacttggtggacctaagattatggcaaccaatggagtagtt
cacctgacagtttcagatgatctagaaggggtatcagctattttaaagtggctgagctat
gttccttcccatgtaggtggcgcacttcctattttgaaaccttcggatcctccagaaaga
cctgttgagtatttccctgaaaacagttgtgatcctcgtgcagccatctgtggtgctcca
aatagcagtgggaagtggctgggtggtttatttgataaggatagctttgttgagacgcta
gaaggttgggcaaggacagttgttacaggaagagcaaagcttggaggaatccctgttgga
atagtagctgttgagacccagactgtgatgcaagttatccctgcagacccaggtcagctc
gattcacatgaaagggttgtccctcaagctgggcaagtatggtttcctgattcggccact
aagacatctcaagcattgttagatttcaacagggaagagctcccacttttcattcttgcc
aactggagagggttctcaggtgggcagagggacctttttgaaggcatccttcaggcagga
tcaaccatagttgaaaatcttagaacatacaagcagcctgtttttgtctacatcccaatg
atgggtgagctgcgtggtggggcatgggttgttgtggacagtcggatcaattcagaccat
attgaaatgtatgctgaacggacagccaaaggaaatgtcctggagccggaagggatgatt
gagatcaagttcaggacaaaggagctgctggagtgcatgggtaggcttgatcaacagctg
atcaatctgaaggcaaaacttcaggaagccaagagcagtagagtgcatggaactgttgag
tctctacagcagcaaataaaagcccgtgagaagcagcttttgccagtctatactcagata
gccaccagatttgcagaattgcatgatacttctctgaggatggctgccaaaggagtgatc
aaagaagttgtggactggggtaactcacggtctttcttttatagaagactgcatcgtaga
gtcatcgagggatcattgatcaaggtcgtgagagatgctgctggtgaccaaatgtcgcat
aaatgtgcaatggacttgatcaaaaaatggtttttggattctgagattgcaagcggcagt
aaagatgcttgggctgatgatcaagctttctttacatggaagaatgatcctgcaaactat
gaggaaaagctacaggagctgcgggcccagaaggtattgcttcacttatcgaaaattggt
gattcggcatcagatttgcaatctctgcctcagggtcttgcagccctcctacagaaggtg
gagccctcaagccgagcgcaattgattggggaactccggaaggtgctcaattga

DBGET integrated database retrieval system