KEGG   Vitis vinifera (wine grape): 100247288Help
Entry
100247288         CDS       T01084                                 

Definition
(RefSeq) acetyl-CoA carboxylase 1-like
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100247288
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100247288
   00640 Propanoate metabolism
    100247288
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100247288
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100247288
Enzymes [BR:vvi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100247288
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100247288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 2266 aa AA seqDB search
MSEVQRGYPMAGLGRGNGLIDGVTLRTPSTSSQIDEFCRALGGTRPIHSILISNNGMAAV
KFIRSVRTWAYETFGTEKAISLVAMATPEDMRINAEHIRMADQFVEVPGGTNNNNYANVQ
LIVEMAEITHVDAVWPGWGHASENPELPDALNAKGIVFLGPPATSMGALGDKIGSSLIAQ
AADVPTLPWSGSHVRIPSESCLVTIPDEVYREACVYTTEEAIASCQVVGYPAMIKASWGG
GGKGIRKVHNDDEVKALFKQVQGEVPGSPIFTMKVASQSRHLEVQLLCDQHGNVAALHSR
DCSVQRRHQKIIEEGPITVAPHETVKKLEQAARRLAKCVNYVGAATVEYLYSMETGEYYF
LELNPRLQVEHPVTEWIAEVNLPAAQVAVGMGIPLWQIPEIRRFYGMEHGGGYDAWRRTS
VVATPFDFDKAESIRPKGHCVAVRVTSEDPDDGFKPTSGKVQELSFKSKPNVWAYFSVKS
GGGIHEFSDSQFGHVFAFGESRALAIATMVLGLKEIQIRGEIRSNVDYTIDLLHASDYRE
NKIHTGWLDSRIAMRVRAERPPWYLSVVGGALYKASASSAAMVSDYVGYLEKGQIPPKHI
SLVNSQVSLNIEGSKYTIDMVRGGPGSYRLRMNESEIESEIHTLRDGGLLMQLDGNSHII
YAEEEAAGTRLLIGGRTCLLQNDHDPSKLVAETPCKLLRYLISDNSHVDADTPYAEVEVM
KMCMPLLSPASGIIQFKMSEGQAMQAGELIARLDLDDPSAVRKAEPFHGSFPILGPPTVI
SGKVHQRCAASINAARMILAGYDHNIDEVVQNLLSCLDSPELPFLQWQECLAVLATRLPK
DLRNELESKYKEFEGISSSQNVEFPAKLLRGVLDAHLCSCPDKEKGAQERLVEPLMSLVK
SYEGGRESHARIIVQSLFEEYLSIEELFSDNIQADVIERLRLQYKKDLLKIVDIVLSHQG
VRSKNKLILRLMEQLVYPNPAAYRDKLIRFSALNHTSYSELALKASQLLEQTKLSELRSS
IARSLSELEMFTEEGENMDTPRRKSAINERMEALVSAPLAVEDALVGLFDHSDHTLQRRV
VETYVRRLYQPYLVKGSVRMQWHRSGLIASWEFLEEHLERKNASEDQISDKSLIEKHNEK
KWGAMVIIKSLQFLPTVISAALRETTHHFEESIPSGSIEQDSHGNMMHIALVGINNQMSL
LQDSGDEDQAQERINKLARILKEQEVSSSLRAAGVGVISCIIQRDEGRAPMRHSFHWSVE
KLYYEEEPLLRHLEPPLSIYLELDKLKGYENIKYTPSRDRQWHLYTVVDKQLPIQRMFLR
TLVRQPTSEGLTLYQGLDVGTTQTQSTMSFTSKSILRSLMTAMEELELHGHNATVKSDHS
HMYLYILQEQQIDDLVPYPKRVVIGAGQEEAGVERILEELAHEIHASVGVRMHRLGVCEW
EVKLCIASAGQAYGSWRVVVANVTGHTCTVHIYRELEDASKHRVVYHSKSAQGHLQGVPV
NAHYQHLGVLDRKRLLARRSNTTYCYDFPLAFETALQQLWASQSQGINRPNDKVLFKVTE
LAFADKRGSWGTHLVPVERTPGENDVGMVAWRMEMSTPEFPNGRTILIVANDVTFKAGSF
GPREDAFFLAVTDLACSEKLPLIYLAANSGARIGVAEEVKACFKIGWSDESSPERGFQYV
YLTPEDYARIGSSVIAHELSMESGETRWVIDTIVGKEDGLGVENLTGSGAIAGAYSRAYK
ETFTLTYVTGRTVGIGAYLARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGP
KIMATNGVVHLTVSDDLEGVSAILKWLSYVPSHVGGALPILKPSDPPERPVEYFPENSCD
PRAAICGAPNSSGKWLGGLFDKDSFVETLEGWARTVVTGRAKLGGIPVGIVAVETQTVMQ
VIPADPGQLDSHERVVPQAGQVWFPDSATKTSQALLDFNREELPLFILANWRGFSGGQRD
LFEGILQAGSTIVENLRTYKQPVFVYIPMMGELRGGAWVVVDSRINSDHIEMYAERTAKG
NVLEPEGMIEIKFRTKELLECMGRLDQQLINLKAKLQEAKSSRVHGTVESLQQQIKAREK
QLLPVYTQIATRFAELHDTSLRMAAKGVIKEVVDWGNSRSFFYRRLHRRVIEGSLIKVVR
DAAGDQMSHKCAMDLIKKWFLDSEIASGSKDAWADDQAFFTWKNDPANYEEKLQELRAQK
VLLHLSKIGDSASDLQSLPQGLAALLQKVEPSSRAQLIGELRKVLN
NT seq 6801 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagttcaaagaggatatccgatggctggtcttggccgggggaatggtttaata
gatggagtaacactaaggaccccatctacatcatctcaaattgatgaattctgccgggct
cttggtgggacaaggccaatacatagcattttaatttcaaacaatggaatggctgctgtc
aagtttatccgcagtgtcaggacatgggcatacgaaacatttggtactgagaaggcaatc
tcattggtggccatggctactcctgaggacatgagaataaatgctgagcatattagaatg
gctgatcagtttgtggaagttcctggtgggactaacaataataactatgccaatgtgcaa
ctcattgtagagatggcagagataacacatgttgatgcagtttggcctggttggggccat
gcatctgagaaccctgagctgccagatgctctgaatgctaaggggattgtatttcttgga
ccccctgcaacatctatgggggcacttggagataagattggttcatcattgattgctcaa
gcagcagatgtacccacccttccatggagtggttcacatgttaggattccttctgaaagt
tgcttggttactatcccagatgaagtgtatcgggaggcatgtgtttatactacagaggaa
gcaattgctagttgtcaggttgtgggttaccctgccatgatcaaggcatcttggggtgga
ggtggcaaaggcataagaaaggttcataatgatgatgaagtcaaggctttgttcaagcaa
gttcaaggtgaagttcctggctcccccatattcacgatgaaggttgcttcccagagtcgc
catttagaagttcagttactatgtgatcagcatggcaatgttgcagccctgcatagccgt
gattgcagtgttcaaaggcgtcatcaaaagattatcgaggaaggtccaattactgtagct
cctcacgagactgtgaaaaagctggagcaggcagcgagaaggttagccaaatgtgtgaat
tatgttggagcagctactgttgagtatttgtacagtatggaaactggcgagtactatttc
ctagagctcaatcctcgattacaggtggagcaccctgtcacggagtggatagcagaagta
aatctgccagcagcccaagttgcagtaggaatggggattcctctctggcaaattcctgaa
ataaggagattctatggaatggaacatggcggaggatatgatgcttggaggagaacatca
gttgttgctaccccttttgattttgacaaagcagagtctataagaccaaaaggccactgt
gtggctgtccgtgtaacaagtgaggacccagatgatggttttaagcccactagcgggaaa
gtacaggagctgagttttaaaagcaagccaaatgtgtgggcatacttctctgttaagtct
ggaggagggattcacgagttctcagattctcaatttggacatgtttttgcatttggagaa
tccagagccttagctattgcaactatggttcttggattgaaggaaattcaaattcgagga
gaaattcgttcaaatgttgattacacaatagatcttttacatgcttctgattacagagag
aataaaatccacaccggttggttggacagtagaattgctatgagggttagagcagaaagg
ccgccttggtatctttctgtggttggaggggctctttacaaagcatctgctagcagtgca
gcaatggtttcagattatgtcggttatcttgaaaaggggcaaatccctcccaagcatata
tctcttgtcaactctcaagtttctttgaacatcgaaggaagcaagtacacaattgacatg
gtaaggggaggaccaggaagctatagactcaggatgaatgagtcggagatagaatcagag
atacacacattacgtgatggtggtttattgatgcagttggatggaaacagtcatattatc
tatgccgaggaagaagcagctggaactcgccttctcattggtggaaggacttgcttgctt
cagaatgatcatgatccatctaagttagtcgcagagacaccatgcaagctgctacggtac
ttaatctcggataatagtcatgttgatgctgacacaccgtatgcagaggttgaggttatg
aagatgtgtatgccacttctttcgcctgcttctggaattattcaatttaagatgtctgaa
ggtcaagcaatgcaggctggtgagcttatagcaagacttgatctagatgatccttctgct
gtaaggaaagcagagcctttccatgggagctttccaattttagggcctcccactgttatt
tctgggaaagttcatcagagatgtgcggcaagcataaatgcagctcggatgatccttgca
ggctacgatcacaatattgatgaagtggtgcaaaacttgttgagttgtcttgatagtcct
gaactccctttccttcagtggcaagagtgcttggctgttttggcaacccgccttcccaaa
gatctccgaaatgaattggaatcaaaatataaggagtttgaagggatatcgagctcccag
aatgttgagttccctgccaaattgttgcggggtgttcttgatgcgcatctatgctcctgt
cctgataaagaaaaaggagcccaagaaagacttgttgagcctttgatgagtcttgtgaag
tcctatgaaggtggaagagagagtcatgcccgcattattgtccagtctctctttgaagag
tacctatctattgaagaactatttagcgataacatccaggcagatgtaattgaacgcctt
cgacttcaatataagaaagatcttctgaagattgtggacattgtgctttctcatcagggt
gtcaggagtaaaaataagctgatattacgtctcatggaacaattggtttaccctaaccct
gctgcatatagagataaactaattcgcttctctgcacttaaccatacaagctattctgag
ttggcactaaaggcaagtcaactactggaacaaaccaaactgagtgaacttcgttccagc
attgcaagaagcctttctgaattagagatgtttactgaagagggtgagaatatggataca
ccaaggaggaaaagtgccatcaatgaacgaatggaggctcttgtgagtgctcctctagca
gttgaagatgcccttgtaggtttgtttgatcacagtgatcacacccttcaaaggcgtgtt
gtggagacttacgtccgccgactataccagccctacctcgtaaaagggagtgttaggatg
caatggcaccgatctggtttgattgcttcctgggaattcttggaagagcatcttgagaga
aagaatgcatcagaagatcaaatttctgacaaatcattaatcgagaaacataatgagaag
aaatggggggccatggttataatcaagtctcttcagtttttgcctactgtaattagtgct
gcattgagggaaacaactcatcactttgaagaatcaattccaagtggatctatagaacaa
gatagccatggtaacatgatgcatattgcattggtgggcatcaacaaccagatgagtttg
cttcaggatagtggtgatgaggatcaggctcaagagagaataaacaagttagccaggata
cttaaggagcaagaagtaagctccagtctccgtgctgcaggtgttggagtaattagctgt
atcatacagagggatgaagggcgagctcccatgaggcactcctttcattggtcagtggag
aagctttattatgaggaagagcctcttctgcgtcacctggaaccacctctatccatttac
cttgaattggacaagctgaaaggctatgagaatataaagtatactccatcaagggaccgt
cagtggcacctatacactgttgtagacaagcaattaccaatccagaggatgtttctcaga
acacttgtaaggcaacccacaagcgaaggattaactttgtaccaggggctggatgtggga
acaacccaaacccaatcgactatgtcttttacttctaagagcattttaagatccttaatg
actgcaatggaggaattggaacttcatggacacaatgctactgtcaaatctgaccattcc
cacatgtacctttacattttacaggagcaacaaatagatgatcttgtgccataccctaag
agagttgtcataggtgctgggcaggaagaagctggagttgaaaggatcctggaagagctg
gcacatgaaattcatgcatctgttggtgtaagaatgcatcggttaggtgtctgtgagtgg
gaagtgaagctttgtatagcatctgctggacaggcctatggttcttggagagtggttgtt
gcaaatgtgactggtcacacctgcactgtgcatatataccgagaattggaagatgccagc
aaacacagagtggtctaccattcaaaatctgcccaaggtcatttgcaaggtgtaccagta
aatgcacactatcagcacttgggagtacttgatcggaagcgtctgttggccaggagaagc
aacactacgtactgctacgatttcccactggcatttgagacagccttgcaacagttatgg
gcatcccagtcccagggcattaacagacccaatgataaagttcttttcaaagtcacagag
cttgcatttgctgacaaaagaggtagctggggtactcatctggttccggtggagcgcaca
cctggagaaaatgatgttggaatggtagcctggcgtatggaaatgtctactcccgagttc
ccaaatggaaggacaattttgatagtagcaaatgacgtaaccttcaaagctgggtctttt
ggcccaagagaggatgcattcttccttgcagtgactgatcttgcttgctctgagaaactg
cccctaatttatttggcagcaaactctggagctcgtattggtgtagctgaggaagtgaaa
gcctgctttaagattggttggtctgatgaatcaagtcctgagcgtggtttccagtatgta
tatttgactcctgaggactatgcacgcattgggtcatctgtgatagctcacgagttaagt
atggaaagtggagaaaccagatgggttatagataccatagtcgggaaggaggatggtttg
ggggttgagaacttaacgggtagtggagccattgctggtgcatattcaagagcatataag
gaaacctttactttaacttatgtgacaggcaggactgttggaataggcgcttatcttgct
cggctcgggatgcggtgcatacagaggctcgatcagcctataattttgactggtttctct
gcattaaacaaacttcttggtcgggaggtgtatagttcccacatgcaacttggtggacct
aagattatggcaaccaatggagtagttcacctgacagtttcagatgatctagaaggggta
tcagctattttaaagtggctgagctatgttccttcccatgtaggtggcgcacttcctatt
ttgaaaccttcggatcctccagaaagacctgttgagtatttccctgaaaacagttgtgat
cctcgtgcagccatctgtggtgctccaaatagcagtgggaagtggctgggtggtttattt
gataaggatagctttgttgagacgctagaaggttgggcaaggacagttgttacaggaaga
gcaaagcttggaggaatccctgttggaatagtagctgttgagacccagactgtgatgcaa
gttatccctgcagacccaggtcagctcgattcacatgaaagggttgtccctcaagctggg
caagtatggtttcctgattcggccactaagacatctcaagcattgttagatttcaacagg
gaagagctcccacttttcattcttgccaactggagagggttctcaggtgggcagagggac
ctttttgaaggcatccttcaggcaggatcaaccatagttgaaaatcttagaacatacaag
cagcctgtttttgtctacatcccaatgatgggtgagctgcgtggtggggcatgggttgtt
gtggacagtcggatcaattcagaccatattgaaatgtatgctgaacggacagccaaagga
aatgtcctggagccggaagggatgattgagatcaagttcaggacaaaggagctgctggag
tgcatgggtaggcttgatcaacagctgatcaatctgaaggcaaaacttcaggaagccaag
agcagtagagtgcatggaactgttgagtctctacagcagcaaataaaagcccgtgagaag
cagcttttgccagtctatactcagatagccaccagatttgcagaattgcatgatacttct
ctgaggatggctgccaaaggagtgatcaaagaagttgtggactggggtaactcacggtct
ttcttttatagaagactgcatcgtagagtcatcgagggatcattgatcaaggtcgtgaga
gatgctgctggtgaccaaatgtcgcataaatgtgcaatggacttgatcaaaaaatggttt
ttggattctgagattgcaagcggcagtaaagatgcttgggctgatgatcaagctttcttt
acatggaagaatgatcctgcaaactatgaggaaaagctacaggagctgcgggcccagaag
gtattgcttcacttatcgaaaattggtgattcggcatcagatttgcaatctctgcctcag
ggtcttgcagccctcctacagaaggtggagccctcaagccgagcgcaattgattggggaa
ctccggaaggtgctcaattga

DBGET integrated database retrieval system