KEGG   Vitis vinifera (wine grape): 100247508Help
Entry
100247508         CDS       T01084                                 

Definition
mitogen-activated protein kinase kinase-like
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:vvi04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 354 aa AA seqDB search
MRRGPLNPSNLKLTLPPDEDSLTKFLTQSGTFMDGDLLVNRDGVRIVSKSEAEVPPLIKP
SDNQLSLADIDTIKVIGKGAGGTVQLVQHKWTGQFFALKVIQMNIQEAALKHIAQELKIN
QSSQCPYVVVCYKSFYDNGAFSIILEYMDGGSLLDFLKKVKSIPEPYLAAICNQVLKGLS
YLHHERHIIHRDLKPSNLLINHRGEVKITDFGVSAILTSTSGQANTFVGTYNYMSPERIS
GGKYGSKSDIWSLGLVLLECATGQFPYSPPEQGEGWTSFYELMEAIVDQPPPCASTNQFS
AEFCSFISACIQKDPNDRKSAHELMAHPFISMYRDLNVDLATYFTNAGSPLATF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaggagagggcccttaaaccctagcaatctcaagctcactctccctcctgatgaggat
tcattgactaagttcctaactcagagtgggacttttatggatggtgatctgctggtcaac
agggatggagttcgaattgtgtctaagagcgaagctgaagtgccaccacttataaagccc
tctgacaaccagttgagcttggctgacatagacacgattaaagtgattgggaagggcgcc
ggtggaactgtgcaattggtgcaacataagtggactggtcaattttttgcgttgaaggtt
attcaaatgaatattcaggaggctgctctcaagcatattgcacaggagctaaaaattaac
cagtcatcacaatgcccatatgttgtcgtgtgttacaagtctttctatgataatggtgcc
ttttctattatcttagagtacatggatggtggatctcttttagattttctgaaaaaggtc
aaatcaattccagagccgtatcttgctgccatctgtaatcaggtgctcaagggtttgtcg
tatcttcatcatgaaagacacatcatccatagggacttaaaaccttctaacttgttaata
aatcacagaggagaagtgaagatcaccgactttggtgtgagtgcaatacttacaagcacc
tctgggcaggcaaatacttttgtcggcacgtacaactatatgtctccagagagaattagt
ggaggtaagtatggctccaaaagtgacatttggagcttggggttggttttgctcgagtgt
gccactggtcagttcccgtattctccaccagagcaaggggaaggatggaccagcttttat
gaacttatggaagccattgttgaccagccaccgccttgtgcatctactaatcaattttct
gcagaattctgctctttcatttctgcatgcatacagaaagacccaaatgacagaaagtca
gcgcatgaacttatggcacatccttttatcagcatgtacagagacttgaatgttgatctt
gcaacatacttcaccaatgcaggatctccactcgctacattttaa

DBGET integrated database retrieval system