KEGG   Vitis vinifera (wine grape): 100248229Help
Entry
100248229         CDS       T01084                                 

Definition
sphingosine kinase B-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100248229
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100248229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 489 aa AA seqDB search
MDQPESQPLISDRFLINGTLTSVDFRDDGKIRWSDGHTDRCLAVEKEVLGFASEGSRIRI
RAIVENGGGLCCVGSRGKLVRKDFVFEIASADSHRLWCQKLREYIDSLGRPKRLFVFVNP
FGGKKSASKIFLDVVSPLLKDADIQLTIQETKHQLHAKAVTQTLDLSKYDGLICVSGDGI
LVEVVNGLLERDDWDSAIKMPIGVIPAGTGNGMAKSLLDSVGDPCSPINAVLAIIRGHKC
SLDVATILQGETKFFSVLMLAWGLVADIDIESEKYRWMGSARLDFYALQRILHLRKYNGC
ISFVPAPGFEAFGEPSTYKGESTSGLNTFNPSQEEPIKVQQHGYQGPNIELEKLQWRTID
GPFVSIWLHNVPWGGEDTLAAPDAKFSDGYLDLIIIRDCPKLPLLALMSELNKGNHIKSP
YVMYFKVKAFVLEPGPCTEDPTKGGIIDSDGEVLARGNGTYKCDQKALMAYDNLQIAVDQ
GLATVFSPI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaccggaaagtcaacctctcatctcggaccggtttctgatcaatggaacccta
acgtcggtggatttccgtgatgacggcaaaattaggtggtcggatggccacactgaccgg
tgcttggcggtggagaaggaggttctgggatttgcctcggaaggttctagaatccggatt
agggctattgtggagaatggaggtggactttgctgtgtcggaagcagagggaaattggtg
aggaaagatttcgtgttcgagattgcgtcggctgattcgcacagactttggtgtcagaag
cttcgtgaatacatcgactctcttggccggccaaaaaggctgtttgtttttgtcaaccca
tttggtgggaagaaatcggcctcaaaaatttttctggatgttgtaagtccattgctcaag
gatgctgatatacaattaacaatccaagaaactaagcatcagctacacgcaaaggcagtt
actcaaacattggatctctcaaagtatgatggcctcatttgtgtcagcggggatggaatt
cttgttgaggtagtaaatggactgcttgaaagagatgattgggattctgcaataaagatg
cctattggggttattcctgcaggaacaggaaatggcatggctaaatctcttttggattca
gttggtgatccttgttcaccaattaatgctgttcttgctattattcgaggtcataagtgt
tcactggatgtggctaccatcttgcaaggggagaccaaattttttagcgtcttgatgctt
gcttggggtctggtggcagatattgacattgagtctgaaaaatataggtggatgggaagt
gctcgtttagatttctacgctctgcaacgaatattgcatttgaggaagtataatggatgt
atatcttttgtgcctgcacctggctttgaagcttttggagagccaagtacttacaaaggt
gaatctactagtggactcaataccttcaatccaagtcaagaggagcctattaaggttcaa
cagcatggttatcagggacctaatattgaattggagaaattacaatggagaaccattgat
ggaccttttgtttccatctggcttcataatgtgccttggggtggtgaagacactctggca
gcacctgatgccaagttctcagatggttacttggacttgattattatacgggattgtcct
aaattacccttgctagcattgatgtcggaattgaacaaaggaaatcatatcaaatcacct
tatgtcatgtactttaaggtgaaagcgtttgttttggagcctggtccttgcactgaggac
ccaaccaagggagggatcatagactcagatggtgaggtcctggccagagggaatgggaca
tacaagtgtgaccagaaggccctgatggcctatgacaacctccaaattgcagtggatcaa
ggtttagctactgttttttcccccatatag

DBGET integrated database retrieval system