KEGG   Vitis vinifera (wine grape): 100248231Help
Entry
100248231         CDS       T01084                                 

Definition
isocitrate lyase-like
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100248231
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    100248231
Enzymes [BR:vvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     100248231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 576 aa AA seqDB search
MAASFGVPSMILEEEGRFEAEVAEVQAWWNSERFKLTRRPYSARDVVALRGNLKQSYGSN
EMAKKLWKTLKTHQANGTASRTFGALDPVQVAMMAKHLDTIYVSGWQCSSTHTTTNEPGP
DLADYPYDTVPNKVEHLYFAQQYHDRKQKEARMSMSREERARTPYVDYLKPIIADGDTGF
GGATATVKLCKLFVERGAAGVHIEDQSSMTKKCGHMAGKVLVSVSEHINRLVAARLQFDV
MGVETVLVARTDAVAANLIQTNVDTRDHQFILGATNPNLKGKGLATILAEAMAAGKTGAE
LQAIEDNWLSVAQLKTFSECVVDAINNLNIREDEKRRRLNEWMNHSGYDKCLSNDQGREI
AERLGLRNLFWDWDLPRTREGFYRFKGSVMAAIVRGWAFAPYADLIWMETASPDLVECTK
FAEGVKSMQPEIMLAYNLSPSFNWDASGMTDEQMRDFIPRIARLGYCWQFITLAGFHADA
LIIDTFARDFARRGMQAYVEKIQREERNNGVDTLAHQKWSGANYYDRVLKTVQGGISSTA
AMGKGVTEEQFKETWTLPRGMGMGEGNTLVIAKSRM
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatcttttggagtgccttcaatgatactggaggaagaagggaggtttgaagca
gaagtagcagaggtgcaagcatggtggaactctgagaggttcaagctaaccaggaggcca
tactcagcccgagatgttgtggctctccgtggcaacctcaagcaaagctatggctccaat
gagatggccaagaagctgtggaaaactctcaagactcaccaagccaatggcactgcctcc
aggacgtttggtgctttggacccagttcaagttgccatgatggccaagcacttggacacc
atctatgtctcaggctggcaatgctcttcaacacacaccactaccaatgagccaggccct
gacttggctgactacccttatgacactgtcccaaacaaggttgagcacctctactttgct
cagcagtaccatgacaggaagcagaaagaggctaggatgagcatgagccgcgaagagaga
gcgagaacgccttatgtggactacttgaagcccatcatagctgatggggatactgggttt
ggtggtgcaactgccactgttaagctctgcaagctgtttgtggagcgtggggctgctgga
gtccacattgaggaccagtcttcaatgacaaagaaatgcgggcacatggccgggaaagtt
cttgtttcagtcagtgagcatatcaataggcttgtggcagcaaggttgcagtttgatgtt
atgggggttgagacagtgttggtggccaggactgatgcagttgcagccaatttgattcag
accaatgtggatactagggatcatcaattcattttgggagcaaccaacccgaaccttaag
gggaagggcttggccactattctagctgaggcaatggccgctggtaagactggggctgaa
cttcaagccattgaggataattggctctcagtggcacagttgaagacattttcagagtgt
gttgtggatgccatcaacaatctgaacataagggaggatgagaagaggaggaggctgaat
gagtggatgaatcattcagggtacgataagtgtctctccaatgaccaaggccgggagatt
gctgaaaggttggggcttcgcaatctgttctgggactgggacttgccgagaacccgagaa
gggttctacaggttcaaagggtcagtaatggctgcaattgtccgtggctgggcttttgct
ccttacgctgacctaatctggatggagaccgcaagcccagacttggttgagtgcaccaag
tttgcagaaggggtgaaatcaatgcagccagagatcatgttggcttacaatctctcccct
tctttcaactgggatgcatcaggaatgacggatgaacagatgagggacttcattccacgg
atcgcccggttgggctactgctggcagttcattacattggccggtttccacgccgatgca
ctcattatcgacacgtttgcgagggactttgcgcgcaggggaatgcaggcttatgtggag
aagatccagagggaggagaggaacaatggagttgacacacttgcacatcagaaatggtct
ggtgcaaattattatgatagggttctcaagactgtccagggaggcatctcctccactgct
gccatggggaaaggagtaacagaagagcaattcaaagagacatggacattgccaagaggg
atggggatgggggaaggcaacactctggtgattgccaagtcaagaatgtag

DBGET integrated database retrieval system