KEGG   Vitis vinifera (wine grape): 100248233Help
Entry
100248233         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 23-like
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100248233
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100248233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 997 aa AA seqDB search
MAEALISNPEANAQENGPSASPHPSSAGSLFHRRIDFHLTRKPYSGFTNGSGGFRLETLN
PTTDPKRSGHSTGPAASSGKKQDGSDHVENGLDPELSIGITVRRIGAGLENLGNTCFLNS
VLQCLTYTEPLAAYLQSGKHQNSCHIAGFCALCAIQKHVSRALQSTGRILAPKDLVSNLR
CISRNFRNARQEDAHEYMVNLLETMHKCCLPSGVPSESPSAYEKSLVHKIFGGLLRSQVK
CMQCSYCSNKFDPFLDLSLEIFKADSLHKALMHFTATEQLDGGERQYQCQRCKQKVKALK
QLTVHKAPYVLTIHLKRFGAHDPGQKIDKKVHFGPTMDLKPFVSGSYEENLKYTLYGVLV
HAGWSTHSGHYYCFVRTSTGMWYSLDDNRVVQVSERTVLDQKAYMLFYVRDRKNFTPKKS
IDVVQKQNLVASAIAKKTYSSVSQGLKETIQNGPVEKSLRGVVASAAVTKNDVSNVGLSK
ESLSKEASAPKSSRFSSECLALKNGPMSEPSPNVALSKQQVKGPPVLNPTLEKSMPPSAP
SVKGSSDCLALKKGPMSKPSPNVALSKQRVKGPPVLNPTLEKSMPPSALSVKGSGITNLG
NAIAATTSAKFNERSEDEISKKDQGILDVIQANCIGSQNSAADKPDSGKTSPKVSIISNA
DETLDKVEPVKLPNGPSGENFQVDSMPKGSAAGDSLIEKADDGGQKLSTKTVEFSSPSSM
MNGSIHMKTLDCKPHRKFKKKNMKCRMRSMHLVSNNLFRASLSLRKKKKHRRSKRHTSDI
KNLTQEHLLEAGCLSVGQGPSTSDKTQTTSVGPTNRWGKRVKHGTKKGDKRTAGKDVKTS
NSECVMDTMDVEFRDRIGEEGAMLATDKEPQKSSISVAKQRDAQRSDSLNDSKRDQMQNG
LMSMLTRGLDETIVARWDEIEWPSNRVMESRSVEGVTIGYVPDEWDEEYDRGKRKKVRSS
NGSFGGPNPFQEIATKKAHFKKAKKDRSSSGNQPFRI
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgttgatctccaacccagaagccaatgctcaggaaaatggtccctcggct
tcgccgcacccgtcttcagctgggtctttgttccacagaagaatcgattttcatctcaca
aggaagccttactctggcttcaccaatggcagcggaggttttcgactagagactctgaac
cccaccacggatccgaagcggtctgggcacagtacgggtccggcggcttcgagtgggaag
aagcaagatgggtctgatcatgtggagaacgggttggatccggagctcagtattgggatc
acagttaggagaattggtgctggtttggaaaatctgggaaatacctgttttcttaattca
gtattgcaatgcctgacttacacagagcctttagcagcatatttgcaaagtggaaagcat
caaaattcttgtcatattgctggattttgtgctttatgtgccatccagaagcatgtcagc
cgtgctcttcagtcaactggaagaatattagcacccaaggatcttgtctctaacttacgg
tgcatatctcggaacttcagaaatgcgagacaggaggatgcacatgagtatatggtaaat
ttgctcgaaacaatgcacaaatgttgcttaccttcaggtgtgccaagtgaatcccctagt
gcttatgagaaaagtttggtgcacaagatctttggtggtctccttcgtagtcaggtgaaa
tgcatgcagtgctcctactgctccaacaaatttgatccatttctagatttgagtcttgaa
atattcaaagcagattccttgcataaggcccttatgcacttcacagcaaccgaacaatta
gatggtggtgagagacagtaccaatgtcagcggtgcaaacagaaagttaaggctctcaaa
cagcttacagttcacaaggcaccttatgttctgaccatccatctaaagcggtttggtgca
catgatcctggacaaaagatcgataagaaagttcattttggtcctacaatggacttaaaa
ccttttgtcagtggttcctatgaagaaaatttgaagtatactctttatggggttttggtt
catgccggttggagcacccattcaggccactattactgctttgttcgcacttcaactggc
atgtggtactcccttgatgacaatcgggttgtccaggttagtgagaggactgttttagat
cagaaggcctacatgttgttttatgttcgtgatagaaaaaacttcactccaaagaaatcc
attgatgttgttcagaaacaaaacttggttgcaagtgccatagcaaagaaaacatattcc
agtgtaagtcaaggtctaaaggaaaccattcaaaatggaccagttgagaaaagtttaaga
ggtgttgttgcttctgctgctgtaactaaaaatgatgtatccaatgttggcttatcaaag
gagagtctgtcaaaagaagcatcagctccaaaaagtagcaggttctcatctgaatgcttg
gcattgaaaaatggtcccatgtctgaaccttcacctaatgtagcattatcaaaacagcag
gtgaaggggcctcctgttctgaaccctactctggagaaatccatgccaccatcagctcca
tctgttaagggatcatctgactgcttggcattgaaaaagggtcccatgtctaaaccttca
cctaatgtagcattatcaaaacagcgggtgaaggggcctcctgttctgaaccctactctg
gagaaatccatgccaccatcagctctatctgttaagggaagtggtatcactaatcttggc
aatgccattgcagctacaaccagtgccaaatttaatgagcgcagtgaggatgaaatttct
aagaaagatcagggcatcttagatgtcatacaagccaactgcatcggttcccaaaattct
gctgctgataagcctgactcagggaagacctctccaaaggttagtattatttcaaatgca
gatgaaacattggacaaagtagaacctgttaagttgccaaatggtccaagtggtgaaaat
tttcaggtcgatagtatgcccaaagggagtgctgctggtgattcacttattgaaaaggct
gatgatggtggccagaaattatcaaccaagacagtagaattttcaagcccgtcaagcatg
atgaatggatctattcacatgaagactcttgattgcaagcctcacagaaaatttaaaaag
aaaaacatgaaatgtaggatgagaagcatgcatcttgtctcaaacaacctcttccgagca
tccttgagcctgcgaaagaagaaaaagcacagaaggagcaaacggcacacttctgatatt
aagaatctcactcaagaacacttactggaagcaggttgtttatctgttggtcagggacca
tccacatctgataaaacccagacaacttctgtgggtccaactaatcgttggggaaaaagg
gttaagcatggtaccaaaaagggagataagagaactgctgggaaggatgtaaaaacctct
aatagtgaatgtgtgatggataccatggatgtggagttcagagacagaattggtgaggag
ggagcaatgcttgcaacagataaagaaccacaaaagagctccatctcggttgcaaaacag
cgggatgcacaaagatctgacagtttaaatgatagcaagagagatcagatgcagaatgga
ctgatgagtatgcttaccagaggtctagacgagacgattgttgctcggtgggatgagata
gaatggccttcaaaccgggttatggaatcacgaagtgtggagggtgtaaccattggttat
gtaccagatgaatgggatgaagaatatgatcggggcaagaggaagaaagtaaggagctcc
aatggtagctttggtggaccaaatccttttcaagagattgcaaccaagaaggcacatttt
aaaaaggcaaagaaggatcggtccagctctggaaaccaaccattcaggatataa

DBGET integrated database retrieval system