KEGG   Vitis vinifera (wine grape): 100248350Help
Entry
100248350         CDS       T01084                                 

Definition
putative glucose-6-phosphate 1-epimerase-like
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100248350
Enzymes [BR:vvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     100248350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 342 aa AA seqDB search
MGKWTVKLAVGFLVFEVLSLREKENRGLVPYYLRPFSLCEMDVSAGGHRVAAEVVKASDG
IDQVVLQNGRGASARVSLHGGQVLSWKTHWGEELLFTSSKAIFKPPVAVRGGIPICFPQF
GSHGTLEQHGFASNKIWIIDDNPPLLPPNDSNGKAYVDLLLKPTENDLKFWPHSFEFRLR
VSLNVDGHLTLISRIRNVDGKPFSFSIAFHTYFSISDISEVRIEGLETLHYLDNLLQKER
FTDQGNTLTFESEVDQVYVNSPDIVAVFDHENKRTFFIKKQGLPDVVVWNPWDKKAKALV
DFGDDEYKQMLCVDGAAIEKPITLRPGEEWTGRLEISVIPST
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggggaaatggacggttaagttggctgttgggttcttggtgtttgaagttttgtctctt
agagagaaggagaatcggggtcttgttccttactacttacgccctttttctctttgtgaa
atggatgtatcagctgggggtcacagagtagcagctgaagttgtaaaggccagcgatgga
attgatcaagttgtgctccaaaacggtcgaggggcttctgctagggttagcttgcatgga
ggccaggttctttcatggaaaacccattggggagaagaactgttattcacaagtagtaag
gcgatcttcaagccaccagtagcagtgagaggaggaattcctatttgttttccacagttt
ggaagccatggaacgctggagcaacatggatttgctagtaacaagatttggattatcgat
gataatcctcctctgctgcctcccaatgattccaatggcaaagcctatgttgacttgctg
ctcaaaccaaccgaaaatgatctgaagttttggccacacagtttcgagtttcgtcttagg
gtgtctctgaatgtggatgggcatctaaccctaatatcacgcattaggaacgtcgatggc
aagccttttagtttctccattgcgtttcatacatatttctccatatcagacatcagcgaa
gtgaggatagaggggttggagactctccactatcttgacaacttactccagaaagagcgt
ttcacggatcaaggaaatacgttaacatttgaatctgaggtggatcaagtttatgttaat
tctccagatatagttgcagtttttgatcatgaaaacaagagaacatttttcataaagaag
caaggacttccagatgtggtggtgtggaatccatgggacaagaaagccaaggccttggtt
gattttggggatgatgagtacaaacagatgctgtgtgttgatggggcagcaatcgagaaa
ccgatcaccttgaggccaggagaggaatggacaggcaggctagaaatttctgtcatcccc
tcaacttaa

DBGET integrated database retrieval system