KEGG   Vitis vinifera (wine grape): 100248352Help
Entry
100248352         CDS       T01084                                 

Definition
(RefSeq) triosephosphate isomerase, cytosolic
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100248352
   01230 Biosynthesis of amino acids
    100248352
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100248352
   00051 Fructose and mannose metabolism
    100248352
   00562 Inositol phosphate metabolism
    100248352
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100248352
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100248352
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100248352
  Exosomal proteins of bladder cancer cells
   100248352
  Exosomal proteins of melanoma cells
   100248352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 254 aa AA seqDB search
MGRKFFIGGNWKCNGTVEEVKKIVTVLNEAEVPSEDIVEVVVSPPFVFLPLVKSLLRSDF
QVAAQNCWIRRGGAFTGEISAEMLVNLGIPWVILGHSERRSLLAESNEFVGDKVAYALSQ
GLKVIACVGETLEQRESGSTMAVVAAQTKAIAEKVSSWDNIVLAYEPVWAIGTGKVATPA
QAQEVHCELRKWLHDNAGDEVAASTRIIYGGSVNGANCKELTTQLDVDGFLVGGASLKPE
FIDIIKSATVKKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggggagaaagtttttcatcggcggcaactggaaatgcaatggaacagttgaggaggtg
aagaagattgttactgttttgaatgaggctgaagttccgtccgaagacattgtggaggtt
gtggtaagtcctccatttgtgtttcttcctttggtaaaaagtttattaaggtctgatttc
caagttgcggcacaaaactgttggattcggagaggaggtgctttcactggtgagatcagt
gctgagatgcttgtcaatttgggcattccttgggttattcttggtcattctgaaagaaga
agtcttttagctgaatcaaatgagtttgttggagataaagttgcatatgcactttcccaa
ggcttgaaagtgattgcttgtgttggggagactcttgagcagcgagaatcgggatctaca
atggctgttgttgctgcacaaactaaagcgattgcagaaaaagtgtcaagctgggataat
attgttttggcttatgaacctgtttgggccattggcactggaaaggttgcaacccctgct
caggcacaggaagtccattgtgaattgaggaaatggcttcatgataatgctggagatgaa
gttgctgcatcaactagaattatttacggaggttctgtaaatggagcaaactgcaaagaa
ttgacaacgcaactagatgtggatggttttttggttggtggagcttccttaaagccggag
ttcatcgacatcatcaagtctgccactgtaaagaagagtgcttaa

DBGET integrated database retrieval system