KEGG   Vitis vinifera (wine grape): 100248516Help
Entry
100248516         CDS       T01084                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    100248516
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     100248516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 471 aa AA seqDB search
MALNLLPPAEIKLISFLDSTKSTRLPKLPGGFVLKRKDYGATFGRRVNCSAQPPPPAWPG
RAVPELGRKTWDGPKPLSVVGSTGSIGTQTLDIVAENPDKFRIVALAAGSNVTLLADQVK
TFKPQLVAVRNEALVNELKEALADCEHKPEIIPGEQGVIEVARHPEAVTVVTGIVGCAGL
KPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGLPEGA
LRRILLTASGGAFRDWPVDKLKEAKVSDALKHPNWNMGKKITVDSATLFNKGLEVIEAHY
LFGAEYDDIEIIIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEITW
PRLDLCKLGSLTFKTPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGYL
DIFKVVELTCDKHQAELVTSPSLEEIVHYDLWARDYAASLHHSSSLMPVPA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaatctcctccctccggcagaaattaagttaatttcgttcctggattccact
aaatccactcgcctccccaagcttccaggtggatttgttttaaagagaaaggattatgga
gcaacatttggtagaagagttaactgttcagcacagccgcctcctccagcctggccagga
cgagctgttcctgagctggggcgcaagacttgggatggtccaaagcctctctcagttgtt
ggatctactggctccattggaactcagacactggacatagttgcagagaatcctgataaa
ttcagaattgtggcacttgcagctggttccaatgtgactcttcttgctgatcaggtgaag
acgttcaagcctcaattagttgctgtgagaaatgaggcattagtcaatgaactcaaagag
gctttggctgactgtgaacacaagcctgagatcatccctggagagcaaggtgtaattgag
gttgcccgccacccagaggcagtcactgtagtgacaggaatagtaggttgcgcaggttta
aaacctacagtggctgcaatagaagcagggaaagacatagccttagccaacaaagagacc
ctaattgctgggggtccttttgtccttcctcttgcacacaagcacaatgtaaagatcctt
cctgctgactcagaacactctgcaatatttcagtgtattcagggtttgcctgagggagca
cttcggcgcattcttttaactgcatctggaggggcattcagggattggcccgttgataaa
ttgaaagaagctaaagtttcagatgctttgaagcatcctaactggaatatggggaaaaag
atcacggttgactcagctacccttttcaataagggtttagaagttattgaagcacactat
ctgtttggggctgaatatgatgatattgagatcataattcatccacaatctatcatacat
tctatggtcgaaacacaggattcgtctgtcctggcacagttggggtggcctgatatgcgt
ttgccaatcctctatactttatcgtggccagacagaatttactgctctgagataacttgg
ccacgacttgatctttgcaagcttgggtcactgacatttaaaactcctgacaatgtgaaa
tatccatccatggatcttgcctatgctgctggacgggctggaggcaccatgacaggagtt
cttagtgcagctaatgagaaggctgtggagatgtttattgatgaaaagattggctatcta
gatatattcaaggtcgtggaactaacatgtgataagcaccaggcagagttagtaacttca
ccatccctcgaggaaatcgtacattatgacctctgggcccgggactatgcagccagttta
catcattcttccagtttaatgcctgttccagcatga

DBGET integrated database retrieval system