KEGG   Vitis vinifera (wine grape): 100248921Help
Entry
100248921         CDS       T01084                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100248921
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100248921
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100248921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 960 aa AA seqDB search
MCENGLEEGEREPSNSSIEEVGHVLCYMLGRIKVDPGKPGSLTWQRKLNSDGNAPVEFKI
NLRETFHLAPIGFRLWRHVREETAKGRGAMIDPFVKRYISSSQGVPLGGIGAGSIGRSYK
GEFQRFQLFPITSENEPVLENQFSVFVSRPNGEKYSTVLCRQSPEALKECPPSGIGSWDW
NLNGNKSTYLALYPRAWTVYDGEPDPALKIVCRQISPIIPHNYKESSFPVAVFTFTLFNS
GKTAADITLLFTWANSVGGVSGLSGQHLNSKFMMKDGVRGVLLHHKTANGRPPVTYAIAA
QEMDGVHISECPCFFISGDTPGITAKDMWNEIKEHGSFDRLNSAETSMPSELGSSVGAAV
AASLTIPSDSEQTVTFSLAWDCPEINFSKERTYYRRYTKFYGTRGDAAAKIAHDAILDHG
HWESQIEAWQKPVLEDKRFPEWYPITLFNELYYLNSGGTVWTDGSPPVHSFTSIIERKFS
LDRSRSDLKNTVSISHHNDTAVDILERMTSVLEQVHTPVTSNSAFGPNLLQQGEENIGQF
LYLEGVEYFMWNTNDVHFYSSFALIMLFPKLELSIQRDFAASVMMHDPSKMKLLCNGKWV
SRKVLGAVPHDVGNYDPWFEVNGYNLYNTDRWKDLNPKFVLQVYRDVVATGDKNFAKAVW
PSVYVALAYMNQFDKDGDGMIENEGFPDQTYDTWSVSGVSAYSGGLWVAALQAASALARV
VGDKGSEDYFWFKFQKAKGVYQKLWNGSYFNYDDSDGSSSSSIQADQLAGQWYARACGLS
PIVDEDKAKSALEKVYHYNVLKVGGGKRGAVNGMLPDGKVDTTTMQSREIWSGVTYGVAA
TMIHEGLVDMAFQTASGVYEAAWSQEGLGYSFQTPESWNTDDQYRSLCYMRPLAIWAMQW
AFSQPKLHKYEANPEMNEDSLVLQHAGFSRVARLLKLPDEDVSRSALQVIYDYTCKRMWL
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagaacggtcttgaggaaggagaaagggaaccttcaaattcttctattgaagag
gtaggccatgttctttgttatatgttgggcagaattaaggttgaccctgggaaacctgga
tccctgacttggcaacgaaaactaaacagtgatggaaatgcccctgtagagttcaaaata
aatcttcgagaaacattccatttggctccaataggttttcggctatggcgtcatgtccga
gaagaaaccgccaaaggaaggggtgcaatgatcgatccttttgtaaagcgttacatttca
tctagtcagggagtccctctaggtggtattggtgcaggaagtattggaagaagttataaa
ggagaatttcagcgctttcaactatttcctataacatcagaaaatgaaccagttttagaa
aatcaattttctgtatttgtttcacgcccaaatggtgaaaaatattctactgtattgtgc
cgacagagcccagaggcactcaaagaatgtccaccatcagggattggatcttgggattgg
aatctgaatgggaacaaatctacatatcttgctttgtatccgagggcttggactgtttat
gatggagaacctgaccctgcacttaaaattgtttgccgacaaatttctcctatcattccc
cataattataaggagagcagcttccctgtagcagtttttactttcacgctatttaattca
gggaagactgctgcagacatcaccttacttttcacatgggcaaattctgtaggaggggtt
tctggactttctggtcagcacttgaattcaaagtttatgatgaaggatggtgtgcggggt
gtactcttacatcataagactgcaaatggacgacccccagtgacttatgcaattgcagca
caagaaatggatggtgttcacatatcagagtgtccttgcttttttatatctggagacacc
cccggtataacagccaaagatatgtggaatgaaataaaagagcatggatcctttgaccgc
ctaaattctgctgaaacatcaatgccttcagaactgggatcatcagtaggggcagccgtt
gctgcttccctgacaattccatcagactcagagcaaacagtgacgttttcattggcatgg
gactgccctgaaataaacttttcaaaagaaaggacttactacaggcgttacacaaaattc
tatggcacccgtggggatgcggcagcaaaaattgctcatgatgctattcttgatcatggc
cactgggagtctcagatagaagcatggcaaaaacccgttctcgaagacaagaggttccct
gaatggtaccccatcactctcttcaatgagctctactatcttaattcagggggaacggtt
tggacagatggatcacctccagtacatagtttcacaagcattatagaaagaaagttctcc
ctagataggtccagatcagatttgaagaacaccgtcagtatatcccatcacaatgacact
gctgttgacatccttgaaaggatgacatcagtacttgagcaagtacacactcctgttaca
tcgaattctgcttttggaccaaatttgcttcaacaaggagaagaaaatattggtcaattc
ctctatcttgaaggggttgagtattttatgtggaatacaaatgatgttcatttctactca
tcttttgcactaatcatgctattcccaaaacttgagctcagcattcaaagagactttgca
gcatcagtaatgatgcatgatcccagtaaaatgaaacttctatgtaatgggaaatgggtt
tcgagaaaggttcttggtgctgttcctcatgatgtcggaaactatgacccctggtttgaa
gtaaatggttataacctttataatacagataggtggaaagatttgaatccaaaattcgtt
ctccaagtttacagggatgtggttgctacaggtgataagaattttgcaaaagcggtttgg
ccctctgtttatgttgcattggcgtatatgaatcagttcgataaggatggggatgggatg
attgagaatgaaggcttccctgatcagacatacgacacatggtcagtttctggcgtgagt
gcatatagtggtgggctctgggtggcagccttgcaggctgcttccgccttggcacgagtg
gtaggggacaagggttctgaggattatttttggtttaagtttcagaaggcaaagggggta
taccaaaagttgtggaatggctcttacttcaattatgatgacagtgatggtagctcaagt
tcatctattcaagcggatcagttggctggacaatggtatgctcgggcttgtggtctttct
ccaattgttgatgaagacaaagcaaaaagtgcactggagaaggtttatcactacaatgtg
ttgaaggtagggggtgggaagcggggggctgtgaatgggatgctgcctgatggaaaagtt
gacacgacaacaatgcagtcaagagaaatatggtctggagtcacatatggtgttgctgca
acgatgatccatgaaggcctggtggatatggcctttcagacagcaagtggagtgtatgaa
gctgcatggtcccaagagggacttggttattcttttcaaactccagagagttggaacaca
gacgaccaatacagatcgctatgttacatgcgacctctggccatatgggccatgcagtgg
gcattctcgcagccaaaacttcacaagtacgaggcgaacccagaaatgaatgaagattct
ctagtactgcagcatgctggattctcaagagtcgcccgcctcctaaagctgccagacgag
gatgtctccaggagtgctttacaggttatctatgactacacttgcaagaggatgtggctc
tga

DBGET integrated database retrieval system