KEGG   Vitis vinifera (wine grape): 100249077Help
Entry
100249077         CDS       T01084                                 

Definition
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100249077
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100249077
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100249077
Lipid biosynthesis proteins [BR:vvi01004]
 Desaturase
  First
   100249077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 382 aa AA seqDB search
MALVISPPNHRSHTFSALTPTTPRTLVGPILRRCILKRIKLSVTYTTSLQSRIRYVIKCQ
SSEDSQALVQRLDNVANANLGSAEQEGGLGNIVVSNEAVRRRRKWNSLDVGTAGVILAMH
FLSVFAPFVFNWSAFWLAMALYAVTGLLGITLSYHRNLSHKSFKLPKWLEYSFAYCGVQA
LQGNPTDWVSTHRYHHQFCDSERDPHTPMRGFWHSHMNWLFDHNSVTEKCGKPNNVGDLE
KQPFYRFISKTYILHPVALGALLYALGGFPFLVWGMGVRIVWVYHITWLVNSACHVWGNQ
AWNTGDLSRNNWWVGLLAFGEGWHNNHHAFEYSARHGLEWWQIDMTWYVVRFLQALGLAT
DVKLPTELHKQRMAFNNSTLLT
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggctttggttatatcgccccccaaccaccgttcccacaccttctctgctctcaccccc
accaccccacgaaccctggtcggtccaattctgagacgctgcattctgaaaaggatcaaa
ctttccgtcacctacacaacctctctccaatctagaattagatatgtgatcaaatgccag
agttctgaggattctcaagccctggtgcagcggttagacaatgtagcgaatgcaaacttg
gggtcagcggagcaggaggggggtttggggaatatcgtggtgtcgaatgaggcggtgcgg
cggcgaaggaagtggaattctttggatgtgggcacagccggagttattttggcaatgcat
tttctgagtgtattcgccccttttgtgttcaactggagtgccttttggcttgccatggcc
ctctatgcggtgactggtctattgggtattacgctgtcctatcataggaacctttcccac
aagagttttaagcttcccaaatggcttgagtactctttcgcctactgtggggttcaagca
cttcaggggaatcccactgactgggttagtacacacaggtaccaccaccagttctgtgat
tctgagagagatccacacacccccatgagaggattttggcatagtcacatgaattggctc
tttgaccacaattctgtaactgagaagtgtggaaaaccaaataatgttggggacttggag
aagcaacccttttaccggttcatttcaaagacttacattcttcatccagtggctcttgga
gctttgttatacgcattgggtggctttcccttccttgtgtggggaatgggggtgaggatt
gtatgggtttaccacataacatggcttgtgaactcagcttgccacgtctggggaaaccaa
gcatggaacacaggcgatctctccaggaacaactggtgggtgggattgcttgcattcgga
gaggggtggcacaataatcaccatgcttttgaatactccgctcgtcatggcctggaatgg
tggcaaattgatatgacttggtacgtggttaggttccttcaagctcttggattggcaacc
gatgtcaaattaccaactgagcttcataagcaacggatggctttcaacaactcaactctg
ctcacatga

DBGET integrated database retrieval system