KEGG   Vitis vinifera (wine grape): 100249200Help
Entry
100249200         CDS       T01084                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial-like
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100249200
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100249200
   00020 Citrate cycle (TCA cycle)
    100249200
   00620 Pyruvate metabolism
    100249200
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100249200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 546 aa AA seqDB search
MLYASRFLTHSRKIRNASNVLRSEPAILVRWFSGGTCSSIDLIEIRRRGFNSSTDGLLSG
VNRAVDPNIYIVGWVRGFNGNISRMAKTMGIPVVGSISNKRFSCLQMHLIRGFATDAGLP
PHQEIGMPSLSPTMTEGNIARWLKKEGDKISPGEVLCEVETDKATVEMECMEEGYLAKIV
LGDGAKEIKVGQVIAITVEEEDDIAKFKGYEAPKGGAADGGKKSSASPPPMKEVAEKPAS
SPQPNVSKAVESSKAGDRIFSSPLAKKLAEDHNVPLQSIKGTGPDGRIVKADIEDYLASY
GKEATTPFSEAATLDYTDLPHTQIRKVTASRLLLSKQTIPHYYLTVDTCVDKLMELRSQL
NTLQEASGGKRISVNDLVIKAAALALRKVPQCNSSWTNDYIRQYHNVNINVAVQTDNGLY
VPVVRDADKKGLSKIAEEIKHLAQKAKDNSLKSEDYEGGTFTVSNLGGPFGVKQFCAIIN
PPQSGILAVGSAEKRVIPGVGPDQFKYASFMPVTLSCDHRVIDGAIGAEWLKAFKGYIEN
PESMLL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatgcatctcgtttcctcacccattccagaaagataaggaatgcttccaatgta
ctgcgaagtgagccggcaatcctggttcggtggttttctggaggaacttgttcttcgatt
gaccttatagagattcgaagacgaggttttaactcttctactgatggcctactgagtggg
gttaatagagctgtagatccaaatatttatatagttggttgggttagaggtttcaatggg
aacatttcaagaatggcaaagacaatgggcatcccagtggttggttccatcagcaacaaa
aggttttcatgtttgcagatgcacctgataagaggttttgcaacagatgcaggacttcct
ccacaccaagagattggtatgccttctctctcccctacaatgacagagggaaatattgcg
aggtggctgaagaaagagggagataaaatttctcctggagaagtattgtgtgaagttgaa
acggataaagcaactgttgagatggaatgcatggaggaaggatatcttgctaagatagta
cttggagatggggcaaaagagatcaaagttgggcaggtgattgctataactgttgaagag
gaggatgatattgccaaattcaagggttatgaagctccaaaagggggtgcagctgatggg
ggtaaaaagtcatctgcttctcctcctcccatgaaagaagtggcagagaagcctgccagt
tcacctcagccaaatgtttcaaaagctgttgaaagttccaaagcaggagatcgcattttt
tccagtcctcttgcaaaaaagttagctgaagatcacaatgttcctcttcaaagcatcaaa
gggacgggtcctgatggacgcattgtgaaggctgatattgaagattatttggcttcttat
gggaaggaagccacaacaccattctctgaggcagcaactttagattacactgaccttcct
catactcagataagaaaggtcactgcttcacgcttgctgctatcaaagcaaactattcct
cattattatttaaccgtggacacttgtgttgacaagctgatggaattgcggagccagctt
aatacactccaagaagcttcaggtggcaagcggatatctgtaaatgatcttgtcataaag
gctgctgctttggctcttcgcaaagttcctcagtgcaatagttcctggaccaatgattac
atccgccagtaccacaatgtgaacataaatgttgctgttcagaccgacaatgggctttat
gtcccagttgtcagggatgcagacaagaaaggattatctaaaattgctgaagagatcaaa
catttagcacagaaggccaaagataacagcctgaaatctgaagactatgagggaggcacc
tttactgtttcgaacttgggaggaccatttggagtcaaacaattttgtgccataatcaat
cctccccaatccggcatcctcgcagttgggtctgctgagaagagggtaatacctggtgtg
ggtcctgaccaattcaagtatgcttcgttcatgcctgtcaccttgagctgtgatcaccgt
gtaattgatggtgccattggtgctgagtggttgaaagcattcaaaggctatattgagaat
ccagagtcaatgctgctctag

DBGET integrated database retrieval system