KEGG   Vitis vinifera (wine grape): 100249393Help
Entry
100249393         CDS       T01084                                 

Definition
(RefSeq) F-box/LRR-repeat protein 3
  KO
K10268  
F-box and leucine-rich repeat protein 2/20
Organism
vvi  Vitis vinifera (wine grape)
Brite
Ubiquitin system [BR:vvi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100249393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 643 aa AA seqDB search
MASPSILCILSDDILARIRSKLSSELDRKTWRLVCRDFLRVDSACRTSLRVLRTEFLPGL
LQKCRNMESLDLSVCPRINDAMVAILLGRGSVCWTRGLRRLVLSRATGLKSAGLELLTRS
CPSLEAVDMSYCCGFGDREASALSCAVGLRELKLDKCLGVTDVGLATIAVGCNKLQRLSL
KWCMELTDLGIDLLVKKCSNLKFLDISYLQVTSESLRSIASLQKLEGLAMSGCSLVGDLG
LHFLGNGCPSLLVIDVSRCDGVSSSGLISLIRGHSDLQQLNAGYSFPELSKMFFRQLKDM
KDLNSIKVDGARVSDFSFQIISANCKCLVEIGLSKCMGVTDLGIMQLVSGCLNLKIVNLT
CCCFITDAAILAVADSCRNLLCLKLESCNLITEKSLDQLGSCCLLLEELDLTDCSGVNDR
GLEYLSRCSELTCLKLGLCANISDKGLFYIASNCKKLRELDLYRCNSIGNDELAALSSGC
KKLEKLNLSYCSEVTDTGMEYISQLKDLSDLELRGLVKITSTGLTAVAAGCMRLAELDLK
HCQKIKDSGFWALAYYSRNLRQINLSNCTVSNMGLCMVMGNLTRLQDAKLVHLSNVTVDG
FELALRASCIRLKKVKLLASLSSLFSSDLLQTLRERGCQIRWD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctccctccattctatgtatcttgtccgacgacatacttgcacggatccgcagc
aagctgagctccgagttggatcggaagacttggcgactcgtctgccgcgacttccttcga
gtcgactcagcgtgtcggacctcgctcagggtcctccgcactgagttcctcccgggtttg
ttgcagaaatgcaggaacatggagagcctggacctctccgtctgtcctcggatcaacgac
gcgatggtggcgattctgctcggtcgtggctcggtgtgctggacacgggggctgaggagg
ctggtgctgagtcgggccactgggttgaaatctgccgggttggagttgctgactcgttcg
tgtccgagcttggaggctgttgatatgtcgtactgttgtgggttcggagatagagaggcc
tcggcgctatcttgcgccgtggggctgagggagctgaagctggacaagtgcttgggtgtg
acggacgttgggctcgcaacgatagccgttggatgcaataagttgcagagattgagtttg
aagtggtgtatggagctcacagatttgggaatcgatcttctggtgaagaagtgttcgaat
ttgaagtttctcgatatttcctatcttcaggtgacaagtgagtctctacgttcaattgct
tctctacaaaagctggagggtttggctatgtcgggatgctctttagtgggtgaccttggt
ttacattttcttggcaatggatgcccttctctcctggtaatagatgtatcgaggtgcgat
ggtgtgagttcatctggcttaatttctctaattagaggacatagtgatctccagcagctc
aatgcaggatactcttttccggaactttctaaaatgttttttcgccagttgaaagacatg
aaggatcttaactcaataaaagttgatggggctcgagtttctgactttagcttccaaatc
atcagcgccaattgcaaatgtttggttgaaatagggttgagtaaatgcatgggggtgact
gacttgggcattatgcagctggtatctggctgtctaaatttgaagattgtcaatctaaca
tgttgctgtttcatcactgatgcagcaattttagctgtagctgactcttgtaggaacctc
ttgtgtctgaagttagagtcatgtaatttgatcactgaaaaaagtcttgatcagcttgga
tcatgttgcttgctgcttgaggagcttgatcttacagactgttctggtgttaatgacaga
ggactggagtatttgtccagatgttcagaactgacatgcttaaaattgggtctttgtgca
aacatatcagataagggattgttctatattgcttctaactgcaaaaagctccgtgaactt
gatctataccgctgtaacagcattggtaatgatgaattagctgctttatcaagtggttgc
aagaagttggagaagcttaacttgtcatactgcagtgaggttactgacacaggaatggag
tatataagccagttgaaagacctttccgacctagagttgcgggggcttgtgaaaattaca
agcactggtttgacagcagttgcagctggatgcatgcgactcgcagaattggacttgaaa
cattgccagaaaatcaaggattctggattttgggctcttgcctactactcacggaattta
cgacagataaacctgagcaattgtactgtatcaaatatggggttatgcatggtgatgggg
aacctgactcgcctgcaggatgcaaaactggtgcacctcagcaatgtgacagtggacggg
tttgagcttgcacttagggcctcttgcattcgattgaaaaaggttaagttactcgcctct
ctcagttctttgttttcctcagacttacttcaaaccctgagggagagaggctgtcaaatt
agatgggattag

DBGET integrated database retrieval system