KEGG   Vitis vinifera (wine grape): 100249580Help
Entry
100249580         CDS       T01084                                 

Definition
uncharacterized LOC100249580
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100249580
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100249580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 461 aa AA seqDB search
MGRSVLELWLLWSVVMRVMIALPIAYSASSTSSQEALLVSRIAFGSCANQSAPQPIWNAI
IDFDPQIFIWLGDNIYGDVRRPFKLFGKERTIGPWKNVPRFIPSSEREMQSRYKKTKTNP
GYSRLLENTKVIGTWDDHDYGLNDAGKEFNGKITSQRLLLDFLDEPQDSPRRKQAGVYTS
YTFGPVDRQIKVILLDTRYHRDPLFSDGSILGSSQWTWLESELKGPASALTIIGSSIQVI
SNLSAITGPIFYLECWGRFPKERERLFKLIADSKRDGVFFISGDVHFGEITRYDCATGYP
LFDITASGITQAVEKAVPPPLNFIVRFVAWLAPTTMRVMGQHCRRKSCTYGQPNFGAIEI
DWDATPVTVKMEVRDVNGFPVLSVNTSLLELQAQSVGALYSIKPGEYRKHCSLEVTLPWI
VRHRLAILFFCALAMLLLTLAGLTFTAISVIRRCLCKDKLD
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggtcggtgttggaactgtggttgctgtggtcggtggtgatgcgagtcatgatc
gccctaccaattgcgtacagcgcttcgtctacttcttctcaagaggctcttcttgtttct
cgaattgcctttggatcatgcgccaaccaaagcgctcctcagcccatatggaatgcaata
attgattttgatcctcaaatttttatttggttgggtgacaacatctatggggatgttagg
cgccctttcaaattatttggaaaagaaaggactattgggccatggaagaatgttcccagg
tttattccttcctcagagcgggaaatgcagtccagatataagaaaactaagacaaatcct
ggttattctcgtcttctagagaatactaaggtgattggtacatgggatgaccatgactat
gggttaaatgatgctggaaaagaatttaatgggaagatcactagccaaaggcttctcctg
gatttcttagatgaacctcaagatagtccacggcgcaagcaggctggtgtttatacatca
tacacatttggtcctgtcgataggcagattaaggttattcttttagatactagataccat
agagatccactgttcagtgacggaagcatattggggagctcacaatggacatggttagaa
agtgagttgaagggccctgcatcagcccttaccataatcggatcctctattcaggttatt
tcaaatctttcagcaataaccggtccaatattttatttagagtgttggggacggtttcca
aaggagagagaacgcctttttaaattgatagcagatagcaagagagatggggtcttcttc
ataagtggagatgttcattttggagaaattaccaggtatgactgtgccactggatatcca
ttgtttgacataacagctagtgggattacccaagctgttgagaaggcagtcccaccacca
ttaaatttcatagtcagatttgtggcatggttagcaccaactacaatgagagttatgggc
caacactgcagacgcaaatcatgcacatatggccagccaaattttggagcaatcgagata
gattgggatgcaactccagtcacagtgaaaatggaagtaagagatgtgaatggatttcca
gtgctaagtgtaaatacctcattattggaactgcaagcccaaagcgtaggagctttgtac
agcattaaacctggagaatataggaagcactgctctcttgaagtcactctaccatggatt
gttagacaccgcctggctattctattcttctgtgctttagctatgttgcttctcaccttg
gctgggctcactttcactgctatatcagttattagacgatgcctctgcaaagacaagctt
gattaa

DBGET integrated database retrieval system