KEGG   Vitis vinifera (wine grape): 100249713Help
Entry
100249713         CDS       T01084                                 

Definition
serine/threonine-protein kinase TOR-like
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
vvi  Vitis vinifera (wine grape)
Brite
Protein kinases [BR:vvi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100249713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 2469 aa AA seqDB search
MASTAQSIRFGAPAAGSSLDALNRILADLCARGPPKDGAALALKIHLEEEARDLSGEAFS
RFMDQLYDRISNLLDSNDVAENMGALRAIDELIDVALGESASKVSKFSGYVRTVFEAKRD
RDVLILASTVLGHLARAGGAMTADEVECQVQNALEWLRGERIEYRRFAAVLILKEMAENA
STVFNVHVPEFVDAIWVALRDPTLPIRERAVEALRACLRVIEKRETRWRVQWYYRMFEAT
QDGLGRNAPVHSIHGSLLAVGELLRNTGEFMMSRYREVADIVITYLEHKDRLVRLSITSL
LPRIAHFLRDRFVTNYLNICMNHILAVLRQPAERDSGFIALGEMAGALDGELVHYMPTII
SHLRDAIAPRRGRPSLDALTCVGSIAKAMGSVMEPYVRSLLDVMFFPGLSHALIEALEQI
TASIPSLLPTIQDRLLDCISIALSRSHYPLARPAVAMARGSTVNTAQQVLDFSSPALVQL
SLQTLAHFNFKGHELLEFARESVVVYLDDEDGATRKDAALCCCSLIANSFSGTTCPQFSS
SRSNRTGGKRRRLVEEIVEKLLIAAIADADVTVRRSIFLSLHENGGFDEFLAQADSLSAV
FAALNDEDFDVREYAISVSGRLSEKNPAYVLPALRRHLIQLLTYLEQSADSKCREESAKL
LGCLIRNCERLILPYIAPIHKALVAKLAEGSGVNANNGIISGVLVTVGDLARVGGSAMRD
NVTDLMPLIVEALMDGAAVTKREVAVATLGQVVQSTGYVIAPYNAYPQLLGLLLKLLNGE
LAWTTRREVLKVLGIMGALDPHVHKRNQQCLPGLHGEVARPASDTGQHIRSMDELPMDLW
PSFATSEDYYSTVAINSLMRILRDASLSSYHQKVVGSLMFIFKSMGLGCVPYLPKVLPDL
FLTVRTCEDGLKEFITWKLGTLVSIVRQHIRKYLPELLLLISELWPSFSLPSSNRPVHGL
PILHLVEQLCLALNDEFRTYLPLILPSCIQVLSDAERCNDYTYVLDILHTLEVFGGTLDE
HMHLLLPALIRLFKVDASVAIRRAAFKTLTRLIPRVQVTGHISALVHHLKLVLDGKNDEL
RKDAVDALCCLAHALGGDFTIFIPSIHKLLMKHRLRHKEFEEIEGRLQRREPLILGSTAA
QRLISRFPVEVTSDPLNDVENDPYEDGSDAQRQIRGHQVNDGRLRTAGEASQRSTKEDWA
EWMRHFSIELLKESPSPALRTCARLAQLQPFVGRELFAAGFVSCWAQLNDTSQKQLVRSL
EMAFSSPNIPPEILATLLNLAEFMEHDEKPLPIDIRLLGALAEKCRAFAKALHYKEMEFE
GARSKKMDANPVAVVEALIHINNQLHQHEAAVGILTYAQQNLDVQLKESWYEKLQRWDDA
LKAYTAKASQASTPHLVLEATLGRMRCLAALARWEELNNLCKEYWTPAEPAARLEMAPMA
ANAAWNMGEWDQMADYVSRLDDGDETKLRVLGNTTASGDGSSNGTFFRAVLLVRRGKYDE
AREFVERARKCLATELAALVLESYDRAYSNMVRVQQLSELEEVIDYCTLPVGNPVAEGRR
ALIRNMWTERIQGAKRNVEVWQVLLAVRALVLPPIEDIENWLKFSYLCRKNGRISQARST
LIKLLQYDPETSPENVRYHGPPQVMVAYLKYQWSLGEDLKRKEAFGRLQNLAIELSSANI
QSATSTGLMSTSSVSVPLLARVYRRLGTWQWALSPALDEDSIQEILSAFRNATQCATKWA
KAWHSWALFNTAVMSHYTLRGFPNIAAQFVVAAVTGYFHSIAFAANAKGVDDSLQDILRL
LTLWFNHGATAEVQMALHKGFSYVNIDTWLVVLPQIIARIHSNNHAVRELIQSLLVRIGE
SHPQALMYPLLVACKSISNLRRAAAQEVVDKVRQHSGTLVDQAQLVSTELIRVAILWHEM
WHEALEEASRLYFGEHNTEGMLKALEPLHEMLEEGAMRDDITAKESAFIQAYRHELLEAY
ECCMKFKRTGKDAELTQAWDLYYHVFRRIDKQLQALTTLDLQSVSPQLLTCRNLELAVPG
QYRAGSPLVTIEYFAHQLVVITSKQRPRKLTIRGSDGEDYAFLLKGHEDLRQDERVMQLF
GLVNTLLENERKTAEKDLSIQRYAVIPLSPNSGLIGWVPHCDTLHHLIREYRDARKITLN
QEHKYMLGFAPDYDHLPLIAKVEVFEYALQNTEGNDLARVLWLKSRTSEVWLDRRTNYTR
SLAVMSMVGYLLGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRM
LVKAMEVSGIEGNFRSTCENVMQVLRTHRDSVMAMMEAFVHDPLINWRLFNFNEVPQMST
FASTHVAPVANSEESAPNRELAQPQRGAREKELLQAVNQLGDANEVLNERAVVVMARMSN
KLTGRDFSTCSSVSASSIQHAVDHSTLIFGDTREVDHGLNVKVQVQKLITQARSHENLCQ
NYVGWCPFW
NT seq 7410 nt NT seq  +upstreamnt  +downstreamnt
atggcttccactgctcaatctatccggttcggcgcccccgccgccggctccagcctcgac
gcccttaaccgcattctcgccgacctttgcgctcgcggccctcccaaggatggggctgca
ttagctttgaagatacatttggaggaagaagctcgtgatcttagtggagaagctttctcc
cgtttcatggatcagttgtatgatcgcatatctaatcttttagacagtaatgatgttgct
gaaaatatgggagctttaagagctattgatgagttgatagatgtggcactaggcgagagt
gcttccaaagtttcaaaattctctggttatgtgcggactgtgtttgaggcaaaacgtgac
cgtgatgttttaatccttgctagtacagttcttggccacctggctagggctggtggagca
atgactgcagatgaagtggagtgccaggtgcaaaatgcattggagtggcttcgtggagaa
aggatagagtatcgtcgtttcgctgctgtgttaatcttgaaagaaatggcagaaaatgct
tcaactgtcttcaatgttcatgtacctgagtttgtggatgctatctgggttgctttgagg
gatccgacattgcccattcgggaacgggctgtagaagcattgcgtgcttgtcttcgtgtt
attgaaaagcgtgaaacacgttggcgtgtgcaatggtattatcgtatgtttgaggctaca
caagatggattgggtagaaatgctccagtacacagtatacatggctctctgcttgcagtt
ggagagcttctgaggaatacaggcgagttcatgatgtcaaggtacagagaagttgcagac
attgttatcacgtacctagagcacaaggaccgacttgttcgccttagtattacctcactg
ttacctcgcattgctcatttcctgcgagatcggtttgttactaactatttgaatatatgc
atgaatcatattcttgcagttttaagacagccagctgaacgtgatagtgggtttattgct
ctaggggagatggctggtgctttggatggggaacttgttcactatatgccgacaattata
tctcatttacgtgatgcgatcgctcctcgaagaggcagaccctctcttgacgctttgact
tgtgttgggagcattgcaaaggctatgggatctgttatggaaccttatgttcgcagcctt
ttagatgttatgttctttcctggtctttcccacgcacttatagaagcccttgaacaaata
actgccagtattccatctttgctacctactattcaagatcgcttgcttgactgcatctca
atagctctttcaagatctcattatcctttagcaaggccggcggttgccatggctcgagga
agcactgtgaatactgctcagcaagtcttagactttagcagtcctgccctagtgcaactt
tctttgcagactcttgctcattttaatttcaagggccatgagcttctcgagtttgcaaga
gagtcggttgttgtatatttggatgatgaagatggagccacgcgaaaagatgctgctcta
tgttgttgtagcttaatagcaaattccttttctggcactacttgtccacaatttagttct
agtaggtccaatcgaactggaggaaaacgccggcgtcttgttgaggagattgtggaaaaa
cttcttattgcagctattgcagatgctgatgttactgttcggcgttcaatctttttgtct
ctgcatgaaaatggaggttttgatgaatttttagcacaagctgatagcttgagtgcggtc
tttgctgctttaaatgatgaggattttgatgttcgagaatatgcaatctcagtttctggg
agattatcagaaaagaatcctgcatatgttcttccagcacttcgtcgccatctcatacag
ttgttgacatatctagagcagagtgcagatagcaaatgtagagaagaaagtgcaaaatta
ctcggttgcttaattcgcaactgtgaacgactaatacttccatacattgctccgatacac
aaggctcttgttgcaaaacttgctgagggctctggggtcaatgctaataatggcatcatc
agtggagttcttgtaactgttggggatcttgcaagagtgggtggttctgcaatgagagat
aatgtaactgatcttatgccattaattgttgaagctctaatggatggagctgctgtcacc
aaacgtgaagtggctgttgcaactcttggtcaagttgtgcaaagcactgggtatgttata
gctccatacaatgcatacccacagttgcttggcttactcttgaagctgcttaatggtgag
ttggcctggactaccaggcgagaagtactaaaggttcttggtattatgggagctttggat
ccacatgtgcataagcgaaatcagcagtgcttgccagggttacatggagaagttgctcgt
ccagctagtgatacaggtcaacacattcgttccatggatgaactgcctatggacctttgg
ccatcttttgcaacatctgaagattattattcaacggttgctatcaattcccttatgcga
attcttagggatgcttcactttctagttaccaccaaaaggttgtgggatctcttatgttt
atatttaagtctatgggtcttggttgtgttccatacttaccaaaggttttgcctgatctt
tttctcactgttcgtacttgtgaagatggcctaaaagaatttatcacctggaagcttgga
actctagtgtctattgttcgccagcatattcgtaaatatctgccagagttgctgttgctt
atttctgaattatggccatccttcagtttgccatctagcaatcgccctgtgcatggctta
ccaattctgcacctagtggaacaactttgcttggctctcaatgatgaattcagaacatat
cttcctctcattcttccatcgtgtattcaagttctgagtgatgcagagaggtgtaatgat
tacacttatgttcttgatattcttcacacccttgaagtgtttggtgggacattggatgaa
catatgcatctactacttcctgcgctcattcgattgttcaaagtggatgcgtcagtggct
ataagacgtgctgccttcaaaaccctgacgagattaattcctcgtgtgcaggtcactggc
cacatctctgctctcgtgcatcatttgaagctagtcttggatggaaagaatgacgagctt
cgaaaggatgctgttgatgcactatgttgtcttgctcatgcccttggaggagacttcacc
atttttattccatcgattcataagcttttgatgaagcatcgcttgcggcacaaagaattt
gaagaaattgaagggcgtttacagaggcgtgagccactaatattgggaagcactgctgct
caacgattaatcagtcggtttccagtggaggttactagtgaccctttaaatgatgtggag
aatgatccttatgaggatggttctgatgcacagagacaaatcagaggccatcaggttaat
gatggtcgattgcgcactgctggagaggcttctcagcgtagtaccaaggaagattgggca
gaatggatgaggcattttagcattgaacttctaaaggaatcaccctctcctgctttacga
acctgtgctaggcttgcacagttgcagccttttgtggggcgggagttgtttgcagctggt
tttgttagctgttgggcacagctaaatgatactagtcaaaagcaattagttcggagttta
gagatggcattttcatctccaaatattcctcctgagattcttgcaacacttcttaatttg
gctgagttcatggaacatgacgagaaacccctccctatagacattcggctccttggagcc
cttgcggaaaagtgccgtgcatttgcaaaggctttgcattataaagaaatggaatttgaa
ggtgcacgttccaagaagatggatgcaaacccagttgctgtagttgaagctcttatacat
ataaataatcaattgcaccaacatgaggctgcagttggaatattgacctatgcccaacaa
aatttggatgtccaattaaaggagtcatggtatgagaaactacagcgctgggatgatgct
ctcaaggcatacacagctaaagcttctcaggcatcaactccacatcttgttctagaagct
acattagggcggatgcggtgccttgctgcattggctcgatgggaagagcttaacaacctg
tgcaaggagtactggaccccagctgaaccagctgcacgactggagatggcaccaatggct
gctaatgctgcatggaacatgggagagtgggatcaaatggcagactatgtttctcggctg
gatgatggtgatgaaacaaaactgagggttttggggaatactactgctagtggtgatgga
agtagtaacggtacattcttcagggcagttttactagttcgtcgaggaaagtatgatgaa
gcgcgggagtttgttgagagagcaaggaaatgtttggcaacagaacttgctgctttggtt
ctagagagctatgatcgtgcctacagcaacatggttcgtgttcagcagctctcagaatta
gaggaggtcattgattattgtactcttcctgtgggaaaccccgttgctgaagggcgacgg
gcccttattcgcaatatgtggactgagcgcatacaaggggcaaagcgaaatgttgaggtc
tggcaagtacttctagcagttagagcacttgtgctgcctcctatcgaggacatcgaaaat
tggctcaagttttcttatctttgccgaaagaacgggcggattagccaggctaggtctacc
ttaattaaacttctacagtatgatcccgaaacatctcctgaaaatgtgcgataccatggc
cctcctcaagtaatggtggcatatttgaagtaccaatggtcccttggggaggatcttaag
cggaaggaagcatttggcaggctgcagaatttagcgatagaactatcaagtgcaaatatt
caatctgctacatcaactggtctgatgagcacttcaagtgtgagtgtcccacttctggcc
cgtgtatatcgtagacttggaacctggcagtgggcactttctcctgcattagatgaagat
tctatacaggaaattctttccgcatttaggaatgcgactcaatgtgcaacaaaatgggct
aaagcatggcattcatgggcactctttaacactgcagtcatgtctcattatactttaaga
ggttttcctaatattgcagcacagtttgttgttgcagccgttactggatattttcattca
atagcgtttgcagcaaatgccaaaggagtggatgatagtttgcaggatatacttcgactc
ctcactttgtggttcaaccatggagctactgctgaggttcaaatggcattacataaagga
ttttcttatgttaatattgacacatggctggttgttttacctcaaataattgccaggata
cattcaaataaccatgctgtgagagaattgatacaatctcttttggtgcgaattggagaa
agccatccacaggctctcatgtacccccttcttgtagcatgtaaatcaattagcaattta
cgcagagcagcagctcaagaagtggttgacaaagtccggcagcatagtggcacacttgta
gatcaggcacaacttgtatcgacggagctaatcagagtggcgatactctggcatgaaatg
tggcatgaggcattggaagaagctagtcgtttatattttggtgagcataatactgagggg
atgctaaaagcattggagcccttacatgaaatgctcgaggaaggggctatgcgggacgat
attaccgccaaagaaagtgccttcattcaggcatatcgccatgaattgttggaggcctat
gaatgctgcatgaaatttaagaggaccggaaaagatgctgaacttactcaggcatgggat
ctatactatcatgtgttcagacggatagataagcagctccaagctcttactaccctggac
ctgcagtctgtttcaccgcagttgttaacatgccgcaatttagagcttgctgttcctggg
caatatcgcgcaggatcaccgttggtcacaattgaatattttgcacatcaacttgttgtc
atcacatctaaacagcgtccccggaaattaaccatacgtggcagtgatggagaagattat
gccttcttgctaaagggacatgaagatttacgccaagatgaacgtgtgatgcagcttttc
ggtctggtgaatactctactggagaatgaaagaaaaacggcagaaaaggatctgtctatt
caacgatatgctgttattccattatctcccaacagtgggttaattggatgggtcccacat
tgtgacaccttgcaccatctcattcgggagtacagggatgccaggaagattaccctcaac
caagagcacaaatacatgcttggttttgctcctgattatgatcatttaccactcattgct
aaagtggaagtatttgagtatgcattgcaaaatactgaaggaaatgacctggcaagggtt
ctttggttgaaaagtcgcacttctgaggtatggcttgacaggaggacaaattatactaga
agtttggctgtcatgagtatggtgggctaccttcttggtttaggtgatcgacacccaagc
aatcttatgcttcatcgctatagtgggaagatcttacacattgattttggtgactgcttt
gaagcttcaatgaaccgagagaagttccctgaaaaggttcccttccgcctgacaaggatg
cttgttaaagctatggaggttagtggtatcgagggcaatttccgttcaacttgtgaaaat
gtaatgcaagtgctccgaacacatagggatagtgtcatggctatgatggaggccttcgtt
catgatcctctcatcaattggcgtcttttcaacttcaatgaagtccctcaaatgtctaca
tttgcaagcactcatgtagctcctgttgcaaatagtgaagaatccgctccaaacagagag
cttgctcaacctcaacgtggtgctcgggagaaggagcttcttcaggctgtcaatcaactt
ggtgatgctaatgaagttctaaatgagcgtgctgtggtggtcatggctcggatgagtaat
aaacttactggacgtgatttttctacttgttcttcagtatccgctagttctatccaacat
gcagtagatcacagtaccttgatttttggtgatacacgtgaagttgatcatggtttaaat
gttaaagtgcaagtccaaaagttgattacccaagctagatcacacgagaatttgtgccaa
aactatgtcgggtggtgtcctttttggtga

DBGET integrated database retrieval system