KEGG   Vitis vinifera (wine grape): 100250245Help
Entry
100250245         CDS       T01084                                 

Definition
rae1-like protein At1g80670
Orthology
K14298  
mRNA export factor
Organism
vvi  Vitis vinifera (wine grape)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100250245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 350 aa AA seqDB search
MSNFSSITTASNPNPNKSIEVAQPPSDSVSSLSFSPKANILVATSWDNQVRCWEIMRNGP
TVGSVPKASISHDQPVLCSAWKDDGTTVFSGGCDKQVKMWPLLSGGQPMTVAMHDAPIKE
VAWIPEMNLLATGSWDKTLKYWDTRQPNPVHTQQLPDRCYALTVRHPLMVVGTADRNLIV
FNLQNPQTEFKRITSPLKYQTRCVAAFPDQQGFLVGSIEGRVGVHHLDDAQQSKNFTFKC
HREGNEIYSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAMSRCSQPIPCSTFNND
GSIFAYSVCYDWSKGAENHNPATAKSYIFLHLPQEAEVKGKPRIGTSGRK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatttctcttcaatcactactgcttccaatccaaatcccaataagtcgattgag
gtggctcaacctccgagtgattctgtttcaagccttagtttcagtcccaaggcaaatatt
ctggtggccacttcatgggataatcaggttcgatgttgggagataatgcggaatgggcca
actgttggcagtgtgcccaaggcatcaatatcacatgaccagccggttctatgctctgct
tggaaggatgatggaacaactgtcttctctggaggctgtgacaagcaagtgaaaatgtgg
cctttgttgtctggcgggcaacctatgactgtggccatgcatgatgctcccattaaagag
gttgcttggatcccagagatgaacctcttagccacaggaagctgggacaagactcttaag
tattgggatacaaggcagcctaatcctgtgcatacccagcaactccctgaccgttgttat
gcactaactgtgagacatcccttgatggttgttggcactgcagatagaaatcttatagtt
tttaacttgcaaaaccctcagactgagtttaagagaatcacttcaccattgaagtatcag
acaagatgtgttgctgcctttccggatcagcaaggattcttggttggctcgatagaggga
agggttggcgtacatcatcttgatgatgcacaacaaagtaaaaactttacttttaaatgc
cacagggaaggcaatgagatatactcagtgaactctctaaacttccatcctgtgcatcac
acatttgccactgcaggctctgacggtgcttttaatttctgggacaaggatagtaaacag
agactcaaggctatgtcaaggtgcagtcaacctataccttgcagtactttcaacaatgat
ggatcgatatttgcatattcggtgtgttatgactggagtaagggtgcagaaaatcataat
ccagcaacagcaaagagctacatcttcctgcatttaccacaggaagctgaggttaaaggc
aaaccaagaattggaacaagtggtagaaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system