KEGG   Vitis vinifera (wine grape): 100250414Help
Entry
100250414         CDS       T01084                                 

Definition
tryptophan synthase beta chain 2, chloroplastic-like
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vvi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:vvi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:vvi00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 477 aa AA seqDB search
MACNLQTSFLPALKFPAEATLDKRRGNALVVCSVASAADSIMTASTPTGSAVVVRPRPLS
RREVETSERKMTGTTGKFGRFGGKFVPETLMTCLSKLEAEFNLVLHDPEFQEELATALRD
YVGRETPLYFAQRLTDHYKNESGCGPEIYLKREDLNHGGAHKINNAIAQAMIAKRMGRTS
IVAATGAGQHGVATAAACAKLSLKCTIVMGTLDMERQASNVLLMKLLGAEVKSVDGNFKN
ATSEAIREWVGNLETNYFLIGTAVGPHPCPSMVREFQSIIGKETRRQAMERWGRKPDVLV
ACVGSGSNALGLFHEFIADEDVRMIGVEAAGFGLESGKHSATLAKGEVGVYHGAMSYLLQ
DEEGQIVGPHSIGVGMEYPGVSPELSFLKETGRVESYSVTDQEAVDAYQLLCRLEGIFPA
LEASHALAFLDKLCPTLPDGGKVVVNCSGRGDKDAPTVFRLTQGSSPGDNKRHPVSP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcaacctccaaacttctttccttcctgctctgaaatttcccgcagaagcaacc
ttggataaaagaagaggcaatgccttggtggtttgctcagttgctagtgctgctgacagc
attatgactgcaagcacaccaactgggtcggccgtggtcgtgaggccaaggccactgtca
aggagagaggttgaaaccagtgagaggaaaatgactggtactacgggaaaatttggaagg
tttggggggaagtttgtgcctgaaacactgatgacttgtttgagcaagcttgaagctgaa
ttcaacctggttttgcatgatcctgaatttcaggaggagctggcgacggcgctaagggac
tatgtgggacgcgagacgcctctctacttcgctcagcgcctcacggatcactacaagaac
gagagtgggtgtgggccagagatttacctaaagagggaggatctcaaccatggtggagca
cacaagatcaacaatgccattgcacaggccatgatcgccaaacgcatgggcaggacgagt
attgtggctgccaccggagctgggcagcacggcgttgcaacagccgctgcgtgtgctaaa
ctttctttgaagtgcaccatcgtcatggggaccttggacatggaaagacaagcatccaat
gtgctcttaatgaagctcttaggtgctgaggttaaatctgttgatgggaattttaagaac
gcaacctcagaagcgatccgggagtgggttgggaatttggaaacaaactacttcttgata
ggcaccgcagtggggcctcacccatgtccaagcatggttcgtgagtttcaatcaataatt
gggaaggaaacaaggagacaggcaatggagagatggggtaggaagcccgatgtgttggtt
gcttgtgtggggagtggctccaatgcactagggctgttccatgaattcatagcggatgaa
gatgtgaggatgattggagttgaggcagctgggtttgggctggagagtgggaaacactct
gcaactttggctaaaggagaggtgggtgtgtaccatggagctatgagctacttgttgcaa
gacgaggaagggcagatagttgggccacactcaattggagttgggatggagtacccaggg
gtgagcccagagctgagctttctcaaagaaacagggcgggtggagtcgtacagtgtcact
gaccaagaagctgtagatgcataccaattattgtgcagattagagggaattttcccagcc
ttggaagcctctcatgctctggcatttctggacaagctatgcccgaccctcccagacggg
ggcaaggttgtagtaaattgtagtgggcgcggagataaggacgccccaactgttttcagg
ctcacacaagggtccagcccaggtgacaacaaaaggcatcctgtgagcccataa

DBGET integrated database retrieval system