KEGG   Vitis vinifera (wine grape): 100250675Help
Entry
100250675         CDS       T01084                                 

Definition
uroporphyrinogen-III synthase, chloroplastic-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vvi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 304 aa AA seqDB search
MAHLSLSSLSPPPSSSSSPPLRLHGRIFSPFCRVQVSSSSTSYLQPKVVVTREHGKNGKL
INVLAEHGINCLEFPLIQHTKGPDLDRLSSVLSDTAFDWIIITSPEAGLVFLEAWKAAGA
PCVKVGVVGSGTQSVFEEVMQSSKQSLRVAFAPSKATGKVLASELPKDGNRTCTVLYPAS
AKASGEIEEGLSSRGFEVTRLNTYTTVPVNDVDEMVFKQALSAPVVAVASPSAVRAWVNL
LSESERWGNAVACIGETTALAAKRSGLRNVYYPTNPGLEGWVDSILEALRVHDRFQKINQ
VVSP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctcacctctctctctcctctctctctcctccaccgtcttcttcttcgtctccgccc
ctgcgacttcacgggagaatcttttctcccttctgccgagtccaagtttcttcctcttct
acttcctacttgcagccgaaagtcgttgttaccagagaacatggcaagaatggcaagctt
atcaatgttctggctgaacatgggattaactgtttggagtttccactcattcaacacaca
aagggacctgatttggataggctttcttctgtattaagtgatactgcatttgactggatc
atcataacttcacctgaagcgggtttggtctttctcgaggcatggaaggctgctggagcc
ccgtgcgtaaaggttggtgttgtaggatctggtacacaaagtgtatttgaagaagtaatg
cagtcctcaaagcaatcactcagagttgcatttgccccatcaaaagcgacaggtaaggtt
ttggcttcagagcttccaaaggatgggaacagaacatgcacagtattatatcctgcatct
gcaaaagctagtggtgagattgaggaaggcctgtctagtcgtggatttgaggtcacaagg
ctgaacacatacacaacggtacctgtcaatgatgtggatgaaatggttttcaagcaagca
ctttctgctcctgttgttgcagtagcttcaccatctgcagttcgtgcttgggtcaatctt
ctttcagaatctgagcggtggggcaatgcagttgcctgtattggtgaaacaactgctttg
gctgcaaaaagatcaggcttgagaaatgtatactacccaacaaatccaggtctagaaggt
tgggttgacagcatccttgaagccttgagagtacatgatcgattccagaagataaatcaa
gttgtctctccttag

DBGET integrated database retrieval system