KEGG   Vitis vinifera (wine grape): 100250787Help
Entry
100250787         CDS       T01084                                 

Definition
rae1-like protein At1g80670
Orthology
K14298  
mRNA export factor
Organism
vvi  Vitis vinifera (wine grape)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:vvi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 345 aa AA seqDB search
MSNFSAANPNPNKSIEVAQPPTDSVSSLKFSPKANFLVATSWDNQVRCWEITRDGATTGS
VPKASISHDQPVLCSAWKDDGTIVFSGGCDKQVKMWPLLSGGQPVTVAMHDAPIKEVAWV
PEMNLLVTGSWDKTIKYWDTRQSNPVHTQQLPDRCYAFTVRHPLMVVGTADRNLIVFNLQ
NPQTEFKRITSPLKYQTRCVAAFPDQQGFLVGSIEGRVGVHHLDDAQQSKNFTFKCHREG
NEIYSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAMSRCSQPIPCSAFNNDGSIF
VYSVCYDWSKGAENHNPSTAKNHIFLHLPQESEVKGKPRVGTSRK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacttctcagctgccaatccaaatccaaacaaatccattgaggtggctcaacct
cctaccgattctgtttcaagccttaaattcagtcccaaggcaaatttcctggtggctacg
tcatgggataaccaggtacgatgttgggagataacaagggatggagctacaacaggcagt
gtacccaaggcatcaatatctcatgatcaaccagttttgtgctcggcttggaaggatgat
ggaacaattgtcttttctggaggctgtgacaagcaagtgaagatgtggcctttgctgtct
ggtggtcaaccagttactgtggccatgcatgatgctcctataaaagaggttgcttgggtt
ccagagatgaacctcttggtcacaggaagctgggacaagaccattaagtattgggacaca
aggcagtcaaatccagtgcatactcaacaactccctgatcgctgttatgcttttaccgtg
agacatcctctgatggttgttggcactgctgatagaaatttgatagtttttaacttgcag
aaccctcagaccgagtttaagagaatcacttcacccctgaagtatcagacaagatgtgtt
gcagcatttcctgatcagcaaggtttcttagttggttcaattgagggaagagttggcgta
caccatctggatgatgcacaacaaagtaaaaactttacttttaaatgtcatcgagaggga
aatgagatatactcagttaactcattaaactttcatccagtgcatcatacatttgcaact
gcagggtctgatggtgcttttaatttttgggacaaggatagtaaacagagacttaaggcg
atgtcaaggtgcagccaacctataccttgcagtgctttcaacaatgatggctcaatattt
gtgtattcagtgtgctatgactggagtaagggtgcagaaaaccataacccatcaacagcg
aagaaccatatttttctacacctgccacaggagtctgaggttaaaggcaagccacgtgtt
ggaacaagtagaaagtga

DBGET integrated database retrieval system