KEGG   Vitis vinifera (wine grape): 100250907Help
Entry
100250907         CDS       T01084                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00010  Glycolysis / Gluconeogenesis
vvi00052  Galactose metabolism
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100250907
   00052 Galactose metabolism
    100250907
Enzymes [BR:vvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100250907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim Flg_new
Motif
Other DBs
NCBI-GeneID: 100250907
NCBI-ProteinID: XP_002282634
Position
17
AA seq 338 aa AA seqDB search
MASERKPEIFELNNGTMQVKITNYGATITSLSVPDKDGNLADVVLGCDSLEPYLKGDVPY
FGCIVGRVANRIKDGKFTLNGIEYQLPINKPPNSLHGGHKGFSKKVWEVAERKEGKTPSI
TFKYHSHDGEEGYPGDVSVTATYTLTSSTTMRLDMEAVPENKPTPINLAQHTYWNLAGHS
SGNILDHSIQIWGSHITPVDQNTVPTGEITPVKATPFDFTTEKKIGTSIHEVGLGYDHNY
ALDCGEEKEGLKHAAKVKDPSSSRVLNLWTTAPGMQFYTANYVNGVAGKDGAVYGKHSGL
CLETQGYPNAINQPNFPSIVVQPGEKYQHTMLFEFSVE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgagcggaaaccagagatctttgaactcaacaatgggaccatgcaggtcaag
atcaccaactatggtgccaccatcacttccttgtctgtaccagacaaagatggaaacttg
gctgatgttgttcttgggtgcgattctctggaaccatatctgaaaggtgatgtgccctat
tttgggtgcattgttggtagagttgcaaatagaatcaaagatgggaagtttactctcaat
gggattgaataccaattgcccatcaacaagcccccaaacagtctccacggtgggcacaag
ggctttagcaagaaggtctgggaggtggctgaaaggaaagaaggcaaaaccccatccatc
actttcaagtaccatagtcacgacggggaagaaggttacccaggagatgtttccgtaact
gcaacttacactcttacttcgagcacaacaatgaggcttgacatggaagctgtgcctgag
aacaagcccactccaatcaacttagctcaacacacatactggaacttagcaggccacagc
tccggcaacatacttgaccactccattcagatatggggatctcatatcactcctgtggat
cagaacacagtcccaaccggtgaaatcacgccagtgaaagccaccccatttgatttcacg
actgagaagaagattggtacctcaatccatgaggttggcctaggatacgaccacaactat
gcactcgactgcggtgaggagaaagagggcttgaaacatgctgcaaaggtgaaggaccca
tcaagctcaagggtcctgaacttgtggacaactgctccaggcatgcagttctacactgca
aactatgtgaatggagttgctggaaaagatggagctgtttatggaaagcattcagggctc
tgcttggagacacagggatacccaaacgccattaaccagccaaacttcccgtccatcgtc
gtccagccaggggagaagtatcaacacaccatgttgtttgagttctccgttgagtga

DBGET integrated database retrieval system