KEGG   Vitis vinifera (wine grape): 100250987Help
Entry
100250987         CDS       T01084                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 462 aa AA seqDB search
MGLKQQAADPAADPKKRRRVGFSNIDTGVEAKDCIKIFLVSRKDEVGASDSFCIDPVDLN
SFFEEDGKIYGYQGLKITVWINSISFHSYANITFQSTSDGGKGITDLKSALQTIFAETLV
ETKDDFLQTFSTERHYIRSMVSNGEILQHKASIGHSSNSGRAEDSDLEVIRMVMGNMAAG
HLYSRLIPLVLLLVDGSNPIDIDDPRWEIYLLVQKKAVGEEDFHYILLGFTAVYRFYHYP
DSSRLRISQILVLPPYQHKGYGHYLLEVLYSVAISEDVHDLTVEEPLDYFQHVRTCVDTP
RLLGFDPIQPAVNSVVSHLKETRLSKKSHTSRLLPPLTAVEEVQKGLKINKKHFLYCWEV
LIYLGLEPIEKYMENYTTFISDRIKSDIIGKDSETSGKRVIEVPSDYDQGMSFVMFRSQD
GEATTVEMDESQANQEEQLQKLVNERLEEIKLVARKLSPRQT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcaagcaacaagccgccgatcctgccgccgaccccaagaagcggcgacgcgtc
ggcttctccaatatcgataccggggttgaagctaaggactgcatcaaaatttttctggtt
tctagaaaagatgaagtcggtgcatcagacagtttctgtattgatccagttgatttgaat
agcttttttgaagaagatggcaaaatttatggttaccaagggttgaagatcactgtctgg
attaacagcatttcatttcattcatatgctaatattacatttcagagcacatctgatgga
ggcaaagggatcacagatctgaaatctgctcttcagacaatttttgctgagacacttgtt
gagacaaaagatgacttccttcaaactttttcaacagagcgtcattatatcagatccatg
gtatcaaacggggagatattgcagcacaaagcctcaattggacacagcagcaattctggc
agagcagaggattctgatctggaggttattcgcatggttatgggcaacatggctgctgga
cacctttacagtcggttgatacctctggttcttctccttgttgatggtagcaatcctatt
gatattgatgatccaagatgggagatctacctcctggttcagaagaaagctgttggggag
gaggatttccattatatattgcttggttttactgctgtttatcgtttctaccattaccct
gatagttcccgcctgcgaatcagtcagatacttgtattgcctccttaccaacacaaaggt
tatggtcattaccttctggaggtgctctacagtgttgcaatatctgaagatgttcatgac
ttgacggttgaagagccactggattacttccaacacgtgcgcacctgtgttgacacacct
cgcctgcttggttttgatccaattcagcctgcagttaattcagttgtttcacatctaaag
gaaaccaggctatcaaagaaatcccacacttctcggcttttgccacccttaactgcagtt
gaggaggtccagaagggtttgaaaataaacaagaaacactttctctactgttgggaggtt
ctcatctatcttggcctggaaccaattgagaagtacatggagaattacacaaccttcatt
tcagatcgcataaagtctgatatcatagggaaggattcggaaacttctgggaagcgggtg
attgaagtcccaagtgactatgatcagggaatgtcttttgtaatgttcaggtcgcaggat
ggagaagctactactgttgagatggatgaaagtcaagccaatcaagaggagcagctgcag
aagttggtcaatgaaagattggaagagatcaagttggttgcacggaaattatctccgcgt
cagacatga

DBGET integrated database retrieval system