KEGG   Vitis vinifera (wine grape): 100251045Help
Entry
100251045         CDS       T01084                                 

Definition
indole-3-glycerol phosphate synthase, chloroplastic-like
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100251045
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100251045
Enzymes [BR:vvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     100251045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 396 aa AA seqDB search
MEGLFSLRATPRVLVPTVSAPNHKPKFSISGTRMEVQKSKKLSVACVRAQQSESKDGSAT
VSPLSDSQENALKIKEWEVGRFQDEIAATQGIRIRRRPPTGPPLHYVGPFEFRLQNEGNT
PRNILEEIVWNKDKEVSQLKERKPLGMLKKALENAPPNRDFIAALRASNLRTGFPGLIAE
VKKASPSRGILREDFDPVEIARAYEKGGAACLSVLTDEKYFKGSFENLELIRNAGVKCPL
LCKEFVVDAWQIYYARTKGADAILLIAAVLPDLDIRYMTKICKMLGLAALVEVHDEREMD
RVLGIEGIELIGINNRNLATFEVDISNTKKLLEGERGEIIRQKDIIVVGESGLFTPADVA
YVQEAGVKAILVGESIVKQKDPRSGITGLFGKDISV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaggggttgttttcattgagagcaacgcctagggttttggttccgaccgtttcggct
ccaaatcacaaacccaagttctcgatttcagggactcgtatggaagtgcagaaaagcaag
aaactttctgttgcctgtgttcgtgctcagcagtctgaatccaaggatggatccgccacg
gtttccccactgagtgattcacaggaaaatgctctcaaaattaaggagtgggaagtgggg
aggttccaagatgaaatagcagctacccagggtataagaatcaggagaagaccaccaact
ggtccaccattgcattatgtgggcccttttgagtttcggttacagaatgagggtaacact
cctcgtaacattttggaagaaattgtatggaacaaggacaaggaagtctcacagttgaaa
gagagaaagcctctcggtatgctgaagaaagctcttgagaatgcccctcccaatagagat
ttcattgcggctcttagggcttccaatctccggactgggtttcctggtttaattgctgaa
gtgaaaaaggcttctccaagcagaggaatcctgagagaggattttgatccggttgaaatt
gcccgagcctatgagaaaggtggagcagcttgtcttagtgttttgactgatgagaagtat
tttaagggaagctttgaaaatctggagttgatacgaaatgccggagtaaagtgccctctg
ctgtgcaaagaatttgtcgtagatgcatggcaaatctactatgctcgaaccaaaggggca
gatgcaattcttctaattgctgctgttttacctgatcttgacatcagatacatgactaag
atttgcaagatgcttgggttggcagcacttgttgaggtacatgatgagagagaaatggat
cgtgttcttggaatagaagggattgaacttattggcatcaataaccgtaaccttgcaaca
tttgaggttgatattagcaacacaaagaagcttcttgaaggagaacgtggtgaaataatc
cgtcaaaaagatataattgttgtcggggagtctgggctgttcactcctgctgatgttgct
tatgtacaagaagctggtgttaaagcaattttggtcggggaatcaattgtcaaacagaag
gaccccaggagtggcataactggacttttcggtaaagatatctctgtatga

  All links  
No link information was found.   
DBGET integrated database retrieval system