KEGG   Vitis vinifera (wine grape): 100251045Help
Entry
100251045         CDS       T01084                                 

Definition
indole-3-glycerol phosphate synthase, chloroplastic-like
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vvi01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:vvi00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 396 aa AA seqDB search
MEGLFSLRATPRVLVPTVSAPNHKPKFSISGTRMEVQKSKKLSVACVRAQQSESKDGSAT
VSPLSDSQENALKIKEWEVGRFQDEIAATQGIRIRRRPPTGPPLHYVGPFEFRLQNEGNT
PRNILEEIVWNKDKEVSQLKERKPLGMLKKALENAPPNRDFIAALRASNLRTGFPGLIAE
VKKASPSRGILREDFDPVEIARAYEKGGAACLSVLTDEKYFKGSFENLELIRNAGVKCPL
LCKEFVVDAWQIYYARTKGADAILLIAAVLPDLDIRYMTKICKMLGLAALVEVHDEREMD
RVLGIEGIELIGINNRNLATFEVDISNTKKLLEGERGEIIRQKDIIVVGESGLFTPADVA
YVQEAGVKAILVGESIVKQKDPRSGITGLFGKDISV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaggggttgttttcattgagagcaacgcctagggttttggttccgaccgtttcggct
ccaaatcacaaacccaagttctcgatttcagggactcgtatggaagtgcagaaaagcaag
aaactttctgttgcctgtgttcgtgctcagcagtctgaatccaaggatggatccgccacg
gtttccccactgagtgattcacaggaaaatgctctcaaaattaaggagtgggaagtgggg
aggttccaagatgaaatagcagctacccagggtataagaatcaggagaagaccaccaact
ggtccaccattgcattatgtgggcccttttgagtttcggttacagaatgagggtaacact
cctcgtaacattttggaagaaattgtatggaacaaggacaaggaagtctcacagttgaaa
gagagaaagcctctcggtatgctgaagaaagctcttgagaatgcccctcccaatagagat
ttcattgcggctcttagggcttccaatctccggactgggtttcctggtttaattgctgaa
gtgaaaaaggcttctccaagcagaggaatcctgagagaggattttgatccggttgaaatt
gcccgagcctatgagaaaggtggagcagcttgtcttagtgttttgactgatgagaagtat
tttaagggaagctttgaaaatctggagttgatacgaaatgccggagtaaagtgccctctg
ctgtgcaaagaatttgtcgtagatgcatggcaaatctactatgctcgaaccaaaggggca
gatgcaattcttctaattgctgctgttttacctgatcttgacatcagatacatgactaag
atttgcaagatgcttgggttggcagcacttgttgaggtacatgatgagagagaaatggat
cgtgttcttggaatagaagggattgaacttattggcatcaataaccgtaaccttgcaaca
tttgaggttgatattagcaacacaaagaagcttcttgaaggagaacgtggtgaaataatc
cgtcaaaaagatataattgttgtcggggagtctgggctgttcactcctgctgatgttgct
tatgtacaagaagctggtgttaaagcaattttggtcggggaatcaattgtcaaacagaag
gaccccaggagtggcataactggacttttcggtaaagatatctctgtatga

DBGET integrated database retrieval system