KEGG   Vitis vinifera (wine grape): 100251166Help
Entry
100251166         CDS       T01084                                 

Definition
guanylate kinase-like
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vvi00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 295 aa AA seqDB search
MLVRRLCTPLTRSDLHLLRPYPKSSKPISISNCRKPFYIKTPKPSAIRYISSTSKMGDAR
RPPAVPIPPVDTENRSELLRALEATLGSSFSSEPLSPPPKPIIIVISGPSGVGKDAVIKK
LREAREGIHFVVTATSRAKREGEVEGKDYYFVSKEEFLGMISRNELLEYALVYGDYKGIP
KQRIREYMTMGYDIVLRVDIQGASTLRKIFGDSAVFIFLVAESELALVKRLIDRKTETKE
TLLVRIATAREEMNHMKNFDYVVVNAEGKLEDAVKLVESIIDAEKAKVRQRSAVV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgctcgttcgaaggctttgcacccctctcacccgttcagacctccaccttctccgccct
tacccaaaatcctcaaaacctatttcaatttccaattgcaggaaacctttttacatcaaa
accccaaaaccctcagccattcgatacatctcgtccacttccaaaatgggagatgcccgg
aggcctcccgctgtccccattccccccgtcgatacagaaaaccggtcggagttgctcaga
gccctcgaggccacattgggttcttcttttagctcggagccactgtctccaccgccgaaa
ccgataatcatagtgattagcggaccgagcggggtgggcaaagatgcagtgatcaagaaa
ttgagggaagccagggagggtattcattttgtggtgacggcgaccagccgggcgaagcgg
gagggtgaagttgaggggaaagattactattttgtcagcaaagaggagtttctagggatg
atatcaaggaatgaacttctggagtatgctctggtgtatggggattataagggcattccg
aaacagcggattcgagagtacatgacgatggggtatgatattgtattgagagtggacata
caaggggcatctacattgaggaagatttttggagattccgcggtgtttatttttcttgtc
gcggagagtgaattggcgcttgtgaagcggttgattgataggaagactgagacgaaggag
acacttcttgtgaggattgcgacagctagagaagagatgaatcatatgaagaattttgat
tatgtggttgtgaacgcggaggggaagcttgaggacgccgttaagttggtggaatcaatc
attgatgcagagaaggctaaagttcggcaaagaagtgctgtggtgtaa

DBGET integrated database retrieval system