KEGG   Vitis vinifera (wine grape): 100251243Help
Entry
100251243         CDS       T01084                                 

Definition
histone acetyltransferase HAC1-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100251243
Transcription factors [BR:vvi03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100251243
Mitochondrial biogenesis [BR:vvi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100251243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 1722 aa AA seqDB search
MNIQAHMSGQMSGQVPNQAGSQLPGLPQQNGSSLPSQIQNLGGHRNTGNMDPDIVRARKS
MQVKIYEYLTQRQSSPYDLQPKKLADIVRRLDDVLFRSAATKEDYANLDTLESRLHGSIK
SLSLSSHNQQFPQAVNSSSAVSTMIPTPGMSHSGSSNLMVTSSVDTSMIAASACNSIAPT
TVNTGSLLPAGGGSSVGIHSSSFNSSDGSLCNGYQQSTSSFSIGSGGNSMMSSMSGQRIT
SQMIPTPGFNSNNNQSYMNSESSNNGGGFSSVESTMVSQPQQQKQHVGGQNIRILHNLGS
QRGSGIRSGLQQKTYGFSNGALNGGFIGNNMQLVNGPSTSDGYLSGTLYGDSSKPLQQQF
DQHQRPLIQGDGYGMNAADPSGSANFYNTVTSAGSMMNTQNLNPVSLQSMSKTNSTLIPN
QSNLQENLLQSHQQQQFQQQPHQFQQQFVPHQRQQKPPSQQHQILIKNDAFGQPQLTSDL
SSQVKAELGGEHHNEILNSQVSDQFQLSELQNQFQQNSSDDHSRGAQLHSLPSGTQEMCS
SVSQNSQQIQQLLHPQQLIAESQNDFSCLSIGEQSESVLHGQWHPQSQGRPQISGNLSHD
QHVQEEFRQRITRHDEAQRNNLSSEGSIIGKTVTPRSTGESQLSAAACKSANSNRERQFK
NQQRWLLFLRHARRCAAPEGKCQDVNCITVQKLWRHMDRCNLPQCSFPRCQHTRVLLHHH
KHCRDPGCPVCIPVKNYLDLQLRARTRPGSDSGLPTPIDGSCKSHDTVETARLTSKASSV
VETSEDLQPSSKRMKTEQPSQSLLPESESSAVLVPVITESHVPQDVQRQEYRHGDVSMPI
KSEFTEVKMEVPVNSGQGSPKISELKKDNLDDIYNQRPDSEPIIYDESAGFAKEENVKLE
KENDQARQENVTQPSESIGTKSGKPKIKGVSLTELFTPEQIRAHITGLRQWVGQSKAKAE
KNQAMERSMSENSCQLCAVEKLTFEPPPIYCSPCGARIKRNAMYYTMGTGDTRHYFCIPC
YNEARGDSVVVDGTSLPKARLEKKKNDEETEEWWVQCDKCEAWQHQICALFNGRRNDGGQ
AEYTCPNCYITEIERGERKPLPQSAVLGAKDLPRTILSDHIEQRLFKRLKQERQERARLQ
GKGFDEVAGAEALVIRVVSSVDKKLEVKQRFLEIFQEENYPTEFPYKSKVILLFQKIEGV
EVCLFGMYVQEFGSECLFPNQRRVYLSYLDSVKYFRPEIKSVTGEALRTFVYHEILIGYL
EYCKKRGFTSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLSMLRKAAKENIVVD
LTNLYDHFFVSTGECKSKVTAARLPYFDGDYWPGAAEDMIYQLQQEEDGRKLHKKGTTKK
TITKRALKASGQSDLSGNASKDLLLMHKLGETISPMKEDFIMVHLQHACTHCCHLMVSGN
RWVCHQCKNFQLCDKCYEAEQKLEERERHPVNHRDKHLLHPVEINDVPSDTKDKDEILES
EFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNICHLDIEAGQ
GWRCEVCPDYDVCNACYQKDGGIDHPHKLTNHPSMADRDAQNKEARQLRVLQLRKMLDLL
VHASQCRSPHCQYPNCRKVKGLFRHGIQCKTRASGGCLLCKKMWYLLQLHARACKESECH
VPRCRDLKEHLRRLQQQSDSRRRAAVMEMMRQRAAEVAGNAG
NT seq 5169 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcaggcacatatgtcaggacaaatgtcagggcaggtacctaatcaagctgga
agtcagttgccgggattgccacagcaaaatggaagttctctcccttcccagattcaaaat
ctaggtggtcatcgcaatacaggcaatatggatcccgacattgtgagagcacgaaaaagc
atgcaagtcaaaatctatgaatatcttacacaacgacagtcatctccttacgatcttcaa
ccgaagaagttggcagatattgttagacgcttagacgatgttttattcaggagtgctgcc
acaaaggaggactatgctaatctggataccttggagagccgtttacatggttcgattaaa
agcttgtctctgagtagtcacaaccaacaatttccacaagcagttaattcttcctctgct
gttagtacaatgataccaacacctggtatgtcacacagcgggagctcaaatttaatggtt
acatcttctgtagatacttccatgattgctgctagtgcatgtaatagcatagcacctaca
actgtcaacactgggagcctgttgccagctggcggtgggtcctcagttggcatacacagc
agttcattcaattcatctgatggatccctgtgtaatggatatcagcaatcaacatccagt
ttttccattggctctggtggaaacagcatgatgtcttcaatgagtgggcaaagaatcaca
agccaaatgattcctacgcctggatttaatagtaataataatcagtcttacatgaattca
gaatcttccaataatgggggtgggttttcgagtgttgaatccacaatggtatcacaacct
caacaacaaaagcagcatgttggtggtcaaaacatccgtatattgcacaaccttggcagt
caaaggggtagtggaattaggtccggtttgcagcagaaaacttatggtttttcaaatggg
gctttaaatggtgggtttattgggaacaatatgcaactggtgaatggacccagcacttct
gatggctatctgtctggcacactgtatggtgattcatccaaacctttacagcagcagttt
gatcaacatcagcgaccccttattcagggtgatggatatgggatgaacgctgctgatcct
tctgggtctgcaaacttctataatactgtaacatcagctggatcaatgatgaatactcaa
aatttgaatccagttagcttgcagtcgatgtccaaaaccaactccactttgatacccaat
cagtcgaatttgcaggaaaacctcttacaatctcatcaacagcaacaatttcagcaacaa
cctcatcagtttcaacaacagtttgttccacatcaacgtcaacagaagccaccaagtcag
cagcaccagattttgataaagaatgatgcttttggtcagcctcagctgacatctgatcta
agcagtcaagtaaaggctgagcttggaggggaacaccataacgaaattctgaattcacaa
gtttctgaccagtttcaactttctgagttgcagaatcaattccagcagaactcttctgat
gaccattctagaggtgctcagttgcactctctaccatctggaacgcaggaaatgtgttca
tcagtgtctcaaaattcacaacaaattcaacagttgttacatccacagcagttgattgcg
gagtctcaaaatgattttagctgcctatctattggagaacaatcagaatcagttctgcat
ggtcaatggcatcctcaatcacaaggcaggcctcaaatatcaggcaacttgtcgcatgat
cagcatgtccaagaagagttccgtcagcgaataaccaggcacgatgaagcccagcgcaat
aatttgtcttcagagggatctatcattggtaaaactgttactccccgaagcacaggggag
tctcaattaagtgctgctgcctgtaaatcggcaaacagtaaccgggaacggcagtttaag
aatcaacagaggtggcttttgttcttgcgacatgctcgtcgttgtgcagccccagaagga
aaatgtcaagatgttaattgcattactgttcaaaagttgtggaggcatatggacagatgt
aatctgccacaatgttcatttccccgttgccagcataccagggtattgcttcatcaccac
aaacattgcagggacccaggatgtcctgtttgtattcctgtcaagaattatttggactta
caactgagagcacgcactcgtccaggttctgattctggcttgccaactcctatagatgga
tcctgtaaatcccatgatactgtagagacagctagattgacttcaaaggcttcttcagtt
gttgaaacctctgaagatctgcagccttcatcaaaacgcatgaaaacagagcagccctcc
caatctcttcttcctgaaagtgaaagttctgcagtattggttcctgtaattactgaatct
catgttccacaggatgtacaacgccaagaataccgacatggtgatgttagtatgccaatt
aaatctgagtttacagaagtgaagatggaagttcctgtgaactctgggcagggaagtcct
aagattagtgaactaaagaaggataatttggatgatatctacaaccaaaggcctgatagt
gaacctattatatatgatgagtctgctggttttgctaaggaagaaaatgttaaacttgag
aaagagaatgatcaggctaggcaggaaaatgtgacacagccttctgaaagtattggaacc
aaatctgggaagccaaaaataaagggggtttcattgactgaactgttcacgccagagcaa
atcagggcccatattacaggtctcaggcagtgggttggacagagcaaggccaaggcagaa
aagaatcaagcaatggagcgttcgatgagtgagaactcttgtcagctgtgtgcagttgag
aagcttacttttgaacctccacctatatattgctcaccatgtggtgctcgtattaagaga
aatgcaatgtattataccatgggaactggtgatacgcgacattatttctgtataccatgc
tataatgaagcccgaggagacagtgtcgtggttgatgggacttctcttcccaaagcaagg
ctggagaagaagaaaaatgatgaggagactgaagaatggtgggttcaatgtgacaaatgt
gaagcttggcaacatcaaatttgtgccttgttcaatggtcggaggaatgatggtgggcag
gctgaatatacttgccctaattgctatataacagagattgagagaggagagcgtaaacca
ttacctcagagtgctgttcttggggctaaagatttgccaaggacaattcttagtgaccac
atagaacagcggttatttaaaagactcaagcaggaaaggcaagagagggcaaggcttcaa
gggaaaggttttgatgaggttgctggagctgaagcacttgtgattagagttgtctcatca
gttgacaaaaagttggaagtgaagcagcggttccttgaaatttttcaagaagagaattac
ccaacggaattcccttataaatctaaggtaattttgttgtttcagaagattgaaggagta
gaagtatgcttatttgggatgtatgttcaagaatttggatcagaatgtctattcccaaat
caacgtcgtgtttatctctcatatctggattctgtgaagtacttcaggcctgagattaaa
tcagtgactggggaggctctccgtacatttgtttaccatgaaattctgattggatatctc
gaatactgtaagaagcggggtttcacaagttgctatatatgggcttgtcctcctttgaag
ggtgaagactatatattgtattgccatcctgaaattcagaaaacaccaaaatctgataaa
ctcagagaatggtatttatcaatgttaagaaaagctgccaaggaaaatattgtggtcgac
cttactaatttatatgaccatttctttgtatctactggtgaatgtaagtctaaggtaact
gcagctaggcttccgtatttcgatggtgattactggcctggtgctgcggaggatatgatc
tatcagcttcaacaagaagaagatggcagaaaactacataagaaaggaactaccaaaaag
actataacaaaaagggctctaaaggcatccggtcaatctgatctttctggcaatgcttca
aaggatttactactaatgcataaacttggtgaaaccataagcccaatgaaggaagatttt
ataatggttcacttgcaacatgcatgtactcattgttgtcatctgatggtatctggaaac
cgttgggtttgccaccagtgcaagaattttcagctttgtgataagtgttatgaagcagag
caaaaacttgaagagagagagagacatcctgtcaatcacagggacaaacatctactccat
ccagttgaaatcaacgacgtaccttcagatactaaggataaggatgagattctggagagt
gaattctttgacaccagacaggcatttctgagtctttgtcaaggaaatcattatcaatat
gataccctacgccgggctaaacattcctctatgatggtcctttaccatcttcacaatcca
actgcacctgcttttgtgactacatgtaatatatgtcaccttgacattgaagctggtcaa
ggttggcgttgtgaggtttgccccgattatgatgtgtgcaacgcatgttatcaaaaggat
gggggtattgaccatccacataaattgaccaatcatccgtccatggccgatcgtgatgca
cagaataaagaagcaaggcagctacgagttttacagctaagaaaaatgcttgatctactg
gtgcatgcatctcaatgccgttctccacattgtcaatatccaaactgtcgcaaagtgaag
ggccttttccgccatgggatacaatgcaaaacacgggcgtctggtggttgtcttctctgc
aagaaaatgtggtatctccttcaacttcatgctcgagcttgcaaggaatctgaatgccat
gtaccacgttgcagagatctgaaggagcatttgaggaggctgcagcagcagtctgattct
aggcgaagagctgctgtgatggagatgatgagacagagagctgcagaggttgctggtaat
gctggatga

DBGET integrated database retrieval system