KEGG   Vitis vinifera (wine grape): 100251405Help
Entry
100251405         CDS       T01084                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00010  Glycolysis / Gluconeogenesis
vvi00020  Citrate cycle (TCA cycle)
vvi00620  Pyruvate metabolism
vvi01100  Metabolic pathways
vvi01110  Biosynthesis of secondary metabolites
vvi01200  Carbon metabolism
Module
vvi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100251405
   00020 Citrate cycle (TCA cycle)
    100251405
   00620 Pyruvate metabolism
    100251405
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100251405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 100251405
NCBI-ProteinID: XP_010654495
UniProt: D7TZW9
Position
9
AA seq 555 aa AA seqDB search
MTYTSRVFNHSKKLRNAPNLLRQEHSTLVRWFSNKARPFSSKGDDILKIPGERYRDCNSP
STASFSHTYRAINTDTITSLGIFEGNVSRTAMKMGIPVTGSLLSKGFSGSCMHLRRGFSS
DSGLPAHQKIGMPSLSPTMTEGNIARWLKKEGDKISPGEVLCEVETDKATVEMECMEEGY
LAKIIQGDGAKEIKVGEVIAITVEEEEDIAKFKDYKPSPSDAAAESKGSSDSTPPKKEEV
KEEPTSSPEPKSSKASAAPSTEGRIFASPLARKLAEEHNVPLSSIKGTGTGGSIVKADIE
DYLASRGKEGSLTAPKVTDTMALDYTDLPHSQIRKITASRLLLSKQTIPHYYLTVDTCVD
KLMDLRSQLNSIQEASGGKRISINDLVIKAAALALRKVPQCNSSWTNDYIRQYHNVNINV
AVQTDNGLFVPVIKDADKKGLSKISEEVKQLAQKAKENNLKPVDYEGGTFTVSNLGGPFG
IKQFCAIINPPQSGILAIGSADKRVVPGTGPDEFKFASFMSVTLSCDHRVIDGAIGAEWL
KAFKSYIENPESMLL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgacctacacatctcgcgtgttcaatcattccaaaaagctaagaaatgctcccaactta
ctacggcaggagcattccactttggtccgttggttttctaacaaggctcgtcccttcagc
agcaaaggagatgatattctgaagatacctggagaaagatatcgggattgtaactctccg
agcactgccagcttcagtcacacttatagagcaataaatactgatacgataacatcgtta
ggaatattcgagggcaatgtttcaaggacagcaatgaaaatgggaattccagtgactggt
tctctgttgagcaaaggtttttcaggttcatgcatgcatctaagaagaggtttttcatca
gattcaggtcttcctgcacatcaaaagattggaatgccttctctttctcctacaatgact
gagggtaacattgcgaggtggttgaagaaagagggtgataaaatctctcctggtgaagtg
ctctgtgaagttgagactgataaagcaacagttgagatggaatgcatggaagaaggatac
cttgctaagataattcaaggagatggggcaaaagaaattaaagttggtgaggtgattgct
ataactgtggaggaagaggaagacattgcaaaattcaaggattataaaccttccccatca
gatgctgcagcggaaagcaaaggatcatctgattctaccccaccaaaaaaagaagaggta
aaagaggaacctaccagttctccagagccaaagagttctaaggctagtgcagctccttca
acagaaggtcgcatttttgctagtcctcttgcaagaaaactggctgaagaacacaatgta
cctctttcaagcatcaaaggaacgggtactggtggaagcattgtgaaggctgatattgaa
gattacttggcttctcgtgggaaggaaggttcactaacagctcctaaggtcaccgataca
atggcattagattacacggacctccctcattctcagataagaaagatcacagcttcacgc
ctattattatcgaagcagactattccccattattatttgacagtggatacatgtgttgac
aaacttatggatttgcgaagccaactcaattcaatacaagaagcttctggtggcaagcgg
atatccatcaatgatcttgtaattaaggctgctgctttggctcttcgaaaagttcctcaa
tgcaatagttcatggaccaatgactatattcgtcagtaccacaatgtgaatatcaatgtt
gctgtgcagacggataatggactctttgtccccgtcatcaaggacgcagacaagaaaggt
ctgtccaagatttctgaagaggtcaagcagttggcccagaaagccaaggagaacaacttg
aagcccgtagattatgagggagggacatttactgtgtctaatctgggaggaccctttggt
atcaagcaattctgtgccatcatcaatcctcctcagtcaggcattctagccattgggtct
gccgacaagagggttgtacctggcacaggccctgatgaattcaagtttgcctccttcatg
tcagtgacactaagctgtgatcatcgtgtcattgatggtgcaattggtgcagaatggctg
aaggcgttcaaatcctatatcgagaacccagaatcaatgttgctgtag

DBGET integrated database retrieval system