KEGG   Vitis vinifera (wine grape): 100251498Help
Entry
100251498         CDS       T01084                                 

Definition
protein disulfide-isomerase 5-2-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100251498
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100251498
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100251498
  Exosomal proteins of colorectal cancer cells
   100251498
  Exosomal proteins of bladder cancer cells
   100251498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 438 aa AA seqDB search
MEGRLSVMGVGVATLSIFALLFSSVSSHDFPTDGTVLELHDSNFDSAISAFDFILVDFYA
PWCGHCKRLAPELDAAAPVLASLKEPIVIAKVNADKFTRLAVKYDIDGFPTLKLFIRGVP
MDYYGPRKADLLVRFLKKFVAPDVSVLVSDSAISSFVEAAGTHFPIYIGFGLNESMISNL
AIKYKKKAWFSVAKDFSEDVMVAYDFDKVPALVSLHPSYNEHSVFYGPFDGEFLEDFMKQ
TLFPLVLPINYDTLKLLKDDDRKIFLTFVDDELDEKSKKLINLLKAAASANRDLVFGFVG
IKQWGEFADSFGANKKTKLPKMVVWDGDNQYFEVIGSESFDEIDQGSQITRFIEGYKEGR
TVEKKIGGPSLIGYINSLIGIRTVYIIVFVVAVMMIIQSINKEEPLTIGSGEDQTDQAWS
SSLTDESREEYRPRDKED
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaagactgagcgtgatgggcgtgggggtggcgaccctctcgatctttgccctt
ctattttcatcagtctcctcccacgatttccccaccgacggcaccgttctcgaactccat
gattccaacttcgattccgccatttctgccttcgactttatcctcgtcgacttctacgcc
ccttggtgcggtcactgcaagcgtctcgctcccgagttagatgcagctgctcccgttctt
gccagtctgaaggaacccatcgtgattgctaaagtaaatgctgacaaatttacccgcctt
gctgttaaatatgacattgacgggtttcctaccctcaagctctttatacgtggtgttccc
atggactactatggaccaaggaaagcagatttacttgttcgcttcctgaaaaagtttgtt
gctcctgatgtctctgttcttgtttcagattctgctataagtagctttgttgaagcagct
ggcactcattttcctatatatataggatttggcttgaatgagtccatgatatcaaactta
gccatcaaatacaagaaaaaggcatggttttcagtggcaaaggatttttcagaggatgtg
atggtggcttatgactttgataaggttcctgctttggtatctcttcatcctagttacaat
gagcacagtgtcttctatggcccctttgatggagaattcttggaggattttatgaaacaa
accttgttccctctggttttgcccataaattatgatacgctgaagttgttgaaagatgat
gataggaaaatttttctgacatttgtggatgatgagcttgatgagaagtcaaagaaattg
attaacttattgaaggctgctgcatctgcaaatcgcgacttagtatttggtttcgttggg
atcaagcagtggggtgaatttgctgattcttttggggctaataagaagacaaaactgcca
aaaatggttgtttgggatggagataatcagtactttgaggttattggttcggaaagcttt
gatgagatagatcaaggttcccaaatcactcgattcattgaagggtataaagaaggaaga
acagtagagaagaaaattggtggtccatcgctgataggctacatcaattcactaattggg
atcagaactgtgtacattatagtttttgtggttgcagtcatgatgattatccaaagcatc
aataaagaagaacctctaaccattggtagtggagaagaccagactgatcaggcttggagc
tcttcccttactgatgaaagcagagaggaatatcggcccagagacaaggaagattaa

DBGET integrated database retrieval system