KEGG   Vitis vinifera (wine grape): 100251499Help
Entry
100251499         CDS       T01084                                 

Definition
beta-galactosidase 17-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100251499
  Lipid metabolism
   00600 Sphingolipid metabolism
    100251499
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100251499
   00604 Glycosphingolipid biosynthesis - ganglio series
    100251499
   00511 Other glycan degradation
    100251499
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100251499
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100251499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 708 aa AA seqDB search
MQRLSGRRASSLRTEASSWSGLLTMARKRSSRTTFFFLSLPFVAAFTFFAPLPSLSSLSP
PLPASSPIRVIGQKFEIKNDKFWKDGQPFQIIGGDLHYFRVHPEYWEDRLLRAKALGLNT
IQTYVPWNLHEPRPGKLVFEGIADIVAFLKLCQKLDFLVMLRPGPYICGEWDLGGFPAWL
LAVNPPLRLRSSDPAFLHLVDRWWGNLLPQIAPLLYDKGGPIIMVQIENEYGSYGDDKAY
LHHLVAVARRHLGNDLILYTTDGGSRETLEKGTIRGDAVFSAVDFSTGDDPRPIFQLQKE
YNAPGKSPPLCAEFYTGWLTHWGENIASTGADFTAAALDKILSLKGSAVLYMAHGGTNFG
FYNGANTGADELDYKPDLTSYDYDAPIRESGDVDNAKFKALRGVVKRHSAASLPSVPSNT
EKRGYGPIQLQKTESLFDLIDKIDPIGVVESENPTSMESVGQMFGFLLYTSGYAAKDQGS
NLFIPNVHDRAQVFISCPSEDNGGRPTYVGTIERWSNQNLSLPDTKCASKINLFVLVENM
GRVNYGSHLFDQKGILSPVYLDGNVLKSWKIVAIPFQNLNEVLDIKPIKEIAHSRINKTL
ALTNIKNTEEVSIEPALYAGRFVVDETKDTFISFSGWGKGIAFVNEFNIGRFWPSTGPQC
NLYVPAPVLRHGENNLVIFELESPNSELVVHSVDHPDFTCRSSSSSML
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggctgagtgggagacgagccagcagtctccgtacagaggcgtcgagctggtca
gggttgttgacaatggccaggaagcgaagctccaggaccaccttcttcttcctctctctt
cccttcgttgctgccttcactttcttcgctcctctcccttccctctcctctctctcccct
cccctccctgcttcgtctccgatcagggtcattggtcaaaagtttgagatcaagaacgac
aaattttggaaagatggtcaacctttccagattattggtggtgatttgcattatttccgg
gttcatcctgagtactgggaagataggctgttgagagcaaaggcattgggcttgaatacc
attcaaacttatgttccttggaatctgcatgaaccaagacctggaaaactggtttttgag
ggtattgcagatatagttgcatttctcaaactctgtcagaagctggattttcttgttatg
cttcgaccaggaccttatatctgtggagagtgggatttgggggggttccctgcctggctg
cttgccgttaatccgcctctcagattaagatcatcggatcctgccttccttcatttggtt
gatagatggtggggaaatctacttccacagatagctcctcttctttatgacaaaggaggc
cctattataatggttcagattgaaaatgaatatggttcatatggggatgataaagcttat
cttcatcacctggttgcagtggccagaagacaccttgggaatgatctaatattgtatact
acagatggaggttctagggaaactcttgaaaaaggcaccattcgtggagatgctgtcttt
tcagctgttgacttctcaactggtgatgatccacgccctatatttcagttgcaaaaggag
tacaatgcaccaggaaagtctccacctctctgcgcggagttctatacaggttggcttaca
cactggggggagaatattgcaagtactggtgctgattttacagctgctgctcttgacaaa
attttgtctctgaagggttccgctgtgctttatatggcacatggtgggacaaactttgga
ttttacaatggtgccaatactggtgcagatgagttggactacaagcctgaccttacttcc
tatgattatgatgcaccaattagagaatctggtgatgtggacaatgcgaagttcaaagca
ttgcgaggggttgtgaagcgacacagtgcagcatctcttccttcagttccttccaacact
gaaaagagaggatatggacctatccagttacagaaaactgaatctttgtttgatttaatt
gataaaatagatcctattggtgtggttgaatctgaaaatccaacttcaatggagtctgtg
ggacagatgtttggatttttattatatacatcaggatatgcagcaaaggaccaaggaagc
aatttgttcataccaaatgtgcatgatagagctcaggtttttatttcatgcccttctgaa
gataatggtggaagaccaacatatgtaggtacaattgaaagatggtcaaatcagaacctg
agccttcctgatactaaatgtgcttccaaaatcaacttatttgttttagttgaaaacatg
ggacgtgtaaattatgggtcacacttgtttgaccagaagggtattttgtctcctgtttat
ctggatgggaatgttctgaagagttggaagattgttgcaattcctttccaaaacctgaat
gaggtgttggatatcaagcccatcaaggagattgcacattccagaatcaataaaacattg
gcccttacgaatataaaaaatactgaggaggtttccatagaaccagcactctatgctggc
cgttttgtagttgatgaaacaaaagacacattcatatcattcagtggatggggtaaaggg
atcgcatttgtcaatgaattcaacataggaagattttggccgtcaactggaccacagtgc
aacctctatgtccctgctccagtgcttagacatggggaaaacaatctggtcatctttgaa
ttagaatcgccaaactctgagcttgtggttcactcagttgatcatccagacttcacatgc
cgttcaagcagttctagcatgctctga

DBGET integrated database retrieval system