KEGG   Vitis vinifera (wine grape): 100251558Help
Entry
100251558         CDS       T01084                                 

Definition
glutathione transferase GST 23-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:vvi00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 223 aa AA seqDB search
MEEEVKLLGAWPSPYSYRVLWALSLKDIKYEYVEEDLSNKSDLLLQYNPVYKKIPVLVHG
GKPISESLVILEYMEETWPQNPLLPQDPYDKAMARFWAKFGEDKGPIFMAIFVTVGEEQE
KAAKEAKEQLTILEEQALGEKKFFGGDKIGLTDIVLGWMAGWLDVIEEVSGLKLLEAEIF
PRLHAWVQRFKEVPGIKEQLPDRDEMLVYYKKKREMFIGSVKP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaggtgaagctgcttggagcttggcctagtccgtatagttacagagtgctg
tgggctctcagcctcaaggatatcaaatatgagtatgtggaagaggatctttccaacaag
agtgacttgctgttgcagtataatcctgtttacaagaagatcccagtgcttgttcatggt
ggaaaacccatctctgagtccctcgttatacttgagtacatggaggagacttggcctcag
aatcctttgctcccacaggacccttatgacaaggccatggctcggttctgggcaaagttt
ggggaggacaagggcccaatttttatggcaatctttgtaactgtgggagaagaacaagag
aaggcagcaaaagaagccaaagaacagctgacaatcttagaagagcaagcgcttggggag
aagaagttttttggaggggacaaaattggactgacggacatagtccttgggtggatggct
ggctggcttgatgtcattgaagaagtatctggcctaaaactgctggaagctgaaatcttc
ccgcgcttgcatgcttgggttcagaggtttaaggaagtccctgggatcaaagagcaactc
cccgatcgcgacgagatgttggtctattacaagaaaaaaagggagatgtttattggatca
gtaaaaccttag

DBGET integrated database retrieval system