KEGG   Vitis vinifera (wine grape): 100251587Help
Entry
100251587         CDS       T01084                                 

Definition
probable glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100251587
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    100251587
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100251587
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100251587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 522 aa AA seqDB search
MAKEDVFVGSIDQGTTSTRFIIYDRSAQPVGSHQVEFTQFYPEAGWVEHDPMEILESVRV
CIEKAIDKATADGHNVDSGLKAIGLTNQRETTLIWSKSTGLPLYHAIVWMDARTSSICRK
LEKELPGGRTHFVETCGLPISTYFSALKLLWLLENVDAVKKAVEAGDALFGTIDTWLIWN
MTGGLNGGVHVTDVSNASRTMLMNLKTLDWDKPTLDTLGISAEILPKIVSNAEIIGTVAK
GWPISGLPISGCLGDQHAAMLGQACRKGEAKSTYGTGAFILLNTGEEVIESKHGLLTTLA
FKLGREAPTNYALEGSIAIAGAAVQWLRDSLGIISTASEIEELAAKVDSSGGVYFVPAFN
GLFAPWWRDDARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEK
GEFLLRVDGGATINNLLMQIQADLLGNPVVRPADIETTALGAAYAAGLAVGIWTEDEIFD
SGEKVKLATTFYPALDEERRNKKVESWCKAVSRTFDLADLSL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagaggatgtcttcgttggatccatagatcaaggcaccaccagtacacggttc
ataatctatgaccggtctgctcagccggttggatctcaccaggtggagttcactcagttc
tacccagaagcaggatgggtggagcatgatccaatggagattttggagagtgtgagagtg
tgcatagagaaggccattgataaggcgactgcagatgggcacaacgtggatagtggattg
aaagcgattgggctgaccaatcagagagagactactctcatctggagcaaatctactggt
cttcctctctaccacgccattgtttggatggatgctagaaccagttctatttgcaggaaa
ttggagaaagaattacctgggggaagaacacattttgtggagacatgtggtttgcccata
agcacttatttcagcgcattgaagcttctctggttgttggaaaatgtggatgctgtgaaa
aaagcagttgaagcaggggatgctctgtttggaacaatagacacttggttgatttggaat
atgactggaggcttgaatggtggggttcatgtcactgatgtctcaaatgcatctagaaca
atgctcatgaatctcaaaacccttgattgggataaacccacattagataccctaggcatt
tctgctgaaattttgcccaagattgtcagtaatgctgagattattggaacagttgcaaag
ggatggcccatttctgggctcccaatttctggatgccttggtgaccagcatgctgcaatg
ctgggccaagcttgccgaaaaggtgaggccaaaagcacatatggtactggggctttcata
cttctcaatacaggtgaggaggtaatcgagtccaaacatgggcttttaaccactttggca
tttaagcttggacgagaagctccaaccaactatgctctagagggctctattgcaattgca
ggagctgcagttcagtggctcagagacagccttggtataataagcactgcaagtgagatt
gaggaattagcagcaaaggttgattcttcaggtggggtttattttgtgccagcgttcaat
ggattgtttgctccatggtggcgtgatgatgcgcgtggggtttgcattgggatcacaaga
tttacaaacaagtctcacattgctcgagctgtgcttgagagtatgtgttttcaggtaaag
gatgtcctagattcaatgcacaaggatgcaggggagaagggtgaggtcaagaatgagaag
ggggaattcttgcttagagttgatggtggtgcaaccattaacaatcttttgatgcaaatt
caggctgatctgttggggaacccggtggttagaccagctgatatagagacaacagctctt
ggagccgcttatgcagctggattagcagtggggatttggacagaagacgagatttttgat
tcgggagaaaaggtgaagcttgctaccacattttatcctgcattagacgaggaacggagg
aataagaaggtggagtcttggtgcaaagctgtttcaaggactttcgacttggcggatctt
tctctttaa

DBGET integrated database retrieval system