KEGG   Vitis vinifera (wine grape): 100251947Help
Entry
100251947         CDS       T01084                                 

Definition
mitogen-activated protein kinase homolog NTF6-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 371 aa AA seqDB search
MENESAAVEVKGVPSYGGKYVQYNVLGNLFEVSAKYVPPIQPVGRGAYGIVCCATNSETN
KEVAIKKIGNAFDNRIDAKRTLREIKLLCHMDHENIVKIKDIIRPPDKEKFNDVYIVYEL
MDTDLHQIIRSSQALTDDHCQYFLYQLLRGLKYIHSANVLHRDLKPSNLLLNADCDLKIC
DFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILMEILRREPLFPG
KDYVQQLVLITELLGSPEDSDLGFLRSDNARKYVKQLPCVPKQPFSEKFPNISPIAMDLV
EKMLVFDPSKRITVEEALNHPFLLPLHEINEEPICPSPFIFDFEQSSLSEDDIKELIWNE
SLNFNPDEMLE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgagtccgcggctgtggaagtgaagggggttccatcctacggtgggaaatac
gtccagtacaacgtgctcggtaacctcttcgaggtctcggctaagtacgttccgccgatt
cagccggttggccgtggcgcctatggaatcgtttgctgtgcgacgaattccgagacaaat
aaggaagtcgcaatcaagaagattgggaatgcatttgacaacaggattgatgctaaaagg
acactccgggagatcaaactcctttgccatatggatcatgaaaatattgtcaaaattaag
gacatcataaggccacctgacaaggaaaagttcaatgatgtgtatattgtttatgaatta
atggatactgatctacatcagataatacgctcttcccaggcactaacagatgatcattgt
cagtatttcctgtatcaattattgcgagggctgaagtatatacactctgccaatgttttg
catcgagatttgaaaccaagcaacctactactgaatgctgactgtgacctcaagatttgt
gactttggacttgcaagaaccacctcagagacagatttcatgacagaatatgttgttacc
cggtggtatcgagcccctgaattgctactcaactgttcagaatatactgcagccattgat
atctggtcagttggttgcattttgatggagatccttagaagagagccactttttcctggt
aaagactatgttcagcagctggtgcttataactgagctattaggttccccggaagattca
gatcttggatttcttagaagtgataatgctaggaagtatgtcaagcagctcccttgtgtt
ccaaagcaacctttctcagagaagtttcctaacatatctccaatagccatggatcttgtg
gagaaaatgctagtttttgatccaagcaagcgcataactgtcgaggaagccttgaatcac
ccatttttgttgcctctccatgagatcaacgaggagcccatctgcccctctcctttcatc
ttcgattttgaacaatcatccttaagtgaagacgatataaaggaactcatatggaatgag
tctctgaatttcaaccctgatgagatgctggagtga

DBGET integrated database retrieval system