KEGG   Vitis vinifera (wine grape): 100251955Help
Entry
100251955         CDS       T01084                                 

Definition
probable histone H2B.1-like
Orthology
K11252  
histone H2B
Organism
vvi  Vitis vinifera (wine grape)
Brite
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100251955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 152 aa AA seqDB search
MAPKAEKKPAEKKPASEKPTEEKKSTVAEKAPAEKKPKAGKKLPKEGAAAGDKKKKRSKK
NVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaaaggcagagaagaagccagcagagaagaagccagcgtcggagaagcctacg
gaggagaagaagtctacggtggcggagaaggctccagcggagaagaagccaaaggccggg
aagaagcttcccaaggaaggcgctgctgccggtgacaagaagaagaagcggtcgaagaag
aacgttgagacctacaagatctacatcttcaaggtcttgaagcaggtccaccccgacatt
gggatttcgagcaaggctatgggaatcatgaacagctttattaacgatatcttcgagaaa
cttgctcaggaggcgtcgaggcttgcaaggtacaataagaagccaactattacatcgagg
gagatccagactgcggtgaggcttgtgttgcctggtgaactggctaagcacgccgtctcc
gagggtaccaaggcggtgaccaagttcacaagttcgtga

DBGET integrated database retrieval system