KEGG   Vitis vinifera (wine grape): 100252603Help
Entry
100252603         CDS       T01084                                 

Definition
mitogen-activated protein kinase kinase 6-like
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    100252603
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100252603
Protein kinases [BR:vvi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100252603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 354 aa AA seqDB search
MKSKKPLKQLKLSVPAQETPITSFLTASGTFQDGDLLLNQKGLRLISEEKEPRPSEAKEL
DVQFSLEDLETIKVIGKGSGGVVQLVRHKWVGTLFALKVIQMNIQENFRKQIVQELKINQ
ASQCSHIVVCYHSFYHNGVISLVLEYMDRGSLVDVIRQVKTILEPYLAVLCKQVLQGLVY
LHHERHVIHRDIKPSNLLVNHKGEVKITDFGVSAMLGSSMGQRDTFVGTYNYMSPERIKG
STYDYSSDIWSLGMVALECAIGHFPYMQSEDQQSGPSFYELLEAIVESPPPSAPPDQFSP
EFCSFISACIQKNPQDRLSSLDLVSHPFIKKFEDKDIDLEILVGSLEPPVNFPR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcaagaagccactgaagcaactgaagctctctgttcctgctcaagaaacccct
atcaccagtttcttgactgcaagtggcacatttcaggatggtgatctgctcttaaaccag
aagggtttgcggcttatctctgaggagaaagaacctcgtccttcagaggctaaggagctt
gatgtacaattttcattggaagatcttgagaccatcaaagtcattggaaagggaagtgga
ggtgttgttcaacttgttcgccacaaatgggttggaacattatttgccttgaaggtcatc
cagatgaatatacaagagaatttccgcaaacaaattgtgcaggagctgaagataaatcaa
gcatcacaatgttcacatattgttgtttgctaccattcgttctatcacaatggagtcatc
tctcttgtcctggaatacatggatcgtggatctttggttgatgtgatcagacaggtcaaa
acaatccttgaaccatatcttgctgttctttgtaagcaggttttacaaggtcttgtgtac
ttgcaccatgaaagacacgtaattcatagggacataaaaccatccaacctgctggtaaac
cacaaaggggaagtaaagattacagattttggtgtgagtgctatgctaggtagctctatg
ggtcagagggacacgtttgttgggacttacaattacatgtcgcctgagagaattaaagga
agcacttatgactacagcagtgatatttggagtctgggcatggtagcacttgaatgtgct
attggacattttccttatatgcaatctgaagaccagcaaagcgggccaagcttttatgag
ctcttagaggcaattgtggaaagcccaccaccatctgctcccccagatcaattctctcca
gaattttgttcttttatatctgcctgcatacagaagaaccctcaagaccgattgtcatca
ttagacctcgtgagtcaccctttcatcaaaaagtttgaagacaaggacattgatctcgaa
attctggtaggcagcttggaacctcctgtaaatttcccaagatag

DBGET integrated database retrieval system