KEGG   Vitis vinifera (wine grape): 100252672Help
Entry
100252672         CDS       T01084                                 

Definition
folic acid synthesis protein fol1-like
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100252672
Enzymes [BR:vvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     100252672
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     100252672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 509 aa AA seqDB search
MIASKVTHAASLILVLIFFAATCVSLLHSSSGTSVEVHSQDQEVVIALGSNVGNRVDNFN
EALQLMKKSGMHITRHGCLYETEPVYVTDQPLFLNSAVRGITKLGPHELLRVLKKIEKDM
GRTDGIRYGPRPIDLDILFYGKFRVNSEILTIPHERIWERPFVMAPLMDVMGSAMESDTV
ASWHSFSKLSGGLFESWEKLGGESLIGKNGLKRVLPTGNVLWDWSLKTSMMGILNLTPDS
FSDGGKFQSVEAAVSQVRLMILEGADIIDIGAQSTRPMASRLSAQEELDRLIPVLDAVLK
MPEVEGKLLSVDTFHSEVASEAIGKGAHIVNDVSAGQLDPNMLDVVASLKVPYVAMHMRG
NPSTMQNSENLQYDNVCEQVASELYLRVRDAELSGIPAWRIIIDPGIGFSKNTEHNLDIL
MGLPNIRMELAGKSLALSHAPMLIGPSRKRFLGDICARPAAAERDPATIAAVTAGVLGGA
NIVRAHNVKDNLDAVKLCDAMVKRERSQA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatcaaaggttacccatgctgcttccctgattcttgttctgatcttctttgca
gcaacatgtgtctctctcctccattcatcctcaggtacatcggtggaagtacattcccaa
gaccaggaagtagtaattgctctaggaagcaatgtgggcaatagagttgacaatttcaat
gaggccttgcagctaatgaagaagtcaggcatgcacataactagacatggatgtttgtat
gagacagagcctgtctatgtgactgatcaacctctctttctcaactctgctgttagaggt
attacaaaacttggtccccatgaactactcagagttctgaagaaaattgaaaaggatatg
ggtcggactgatggaataaggtatggtccgagaccaattgacctggatattttgttctat
gggaagttcagggttaactctgagattcttaccatcccccatgaaagaatttgggagaga
ccttttgtgatggccccattgatggatgtaatgggatcagctatggagagtgatacggtt
gcatcctggcattctttttcaaaacttagtgggggactatttgagtcatgggagaaactt
ggtggcgaatccctcattggaaagaacgggttgaaaagggttttacccactggaaatgtt
ttatgggactggtcactgaaaacctctatgatgggtatccttaatctgaccccagatagt
tttagtgatggagggaagttccagtctgtggaggctgcagtttctcaggtccgcttgatg
atcttagaaggggcagatattattgatattggtgcacagtccacacgcccaatggcatct
aggctttcagctcaagaggaattagataggttaatccctgtcttggatgctgttctaaag
atgcctgaggtagaggggaagctgttatctgtggatacttttcattctgaagttgcttca
gaagcaattggcaagggagctcatattgtaaatgatgtatctgcaggacagctagatcct
aacatgcttgatgttgttgccagccttaaggttccatatgttgctatgcacatgaggggg
aacccatctaccatgcagaatagcgagaacctgcaatacgataatgtttgcgagcaggtt
gcctctgagttatacttgcgagttagagatgctgaattatctggtattccagcctggagg
ataattattgaccctggaattggattctcaaagaacactgaacataatttggacattctc
atggggttgccaaacatacgaatggagcttgcagggaagagtttggctctctctcatgct
cctatgttgattggaccctcgaggaagagatttttaggtgatatttgtgctcgccctgct
gcagctgagagagaccctgcaaccattgctgctgtgactgctggggttttgggcggtgca
aacattgttagggcacataatgtcaaagataatttagatgctgtgaagctctgtgatgca
atggtgaagcgtgagagatctcaggcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system