KEGG   Vitis vinifera (wine grape): 100252789Help
Entry
100252789         CDS       T01084                                 

Definition
cyclin-H1-1-like
Orthology
K06634  
cyclin H
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:vvi03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:vvi03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 335 aa AA seqDB search
MADFQTSTHRSKWIFTPQDLIEKYKAANQRAKQTLEKYGVTRIEVDADGSLQYPEPQISA
KDNAEKRSRPKPLNFEEERFMRSFYEYKIQEVCAAFSFPHKIQATALIYYKRFYLQWSVM
EHHPKHIMLTCIYAACKIEENHVSAEELGKGIAQDHQMILNNEMIVLQSLDFDLIVFAPY
RSVEGFVDDMEEFCQAKNDRLQMLKDLHKTAKMEVDKTMLTDAPLLFPPGQLALAALRRS
NEVHQVLDFERYLSSILSRQDFSHAFSELTESLNAIDSWVMKHQVPTTEDMKHIDRKLKF
CLDPSSHDKSKKREKKSKHKSKRSASEMQNLPPGA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggccgatttccaaacctccactcaccgatctaagtggatcttcactcctcaagacctg
attgaaaagtacaaagctgccaatcagagagcaaaacaaacattggagaagtatggagta
acacgcattgaagtagatgctgatgggtcattgcaataccctgaacctcaaattagtgca
aaagacaatgctgaaaagcgttctcgacccaaaccacttaattttgaagaagaacgattt
atgcggtcattctatgagtataagattcaagaagtatgtgcagccttctctttccctcac
aaaattcaggcaacagctctcatatactacaaaaggttttatctgcagtggtcggtcatg
gaacatcacccaaaacacataatgttaacctgcatatatgcagcttgtaagatagaagaa
aaccatgtatcagcggaggagctcggtaaggggattgcacaagatcaccaaatgattctc
aataatgagatgatagttcttcagagtctagattttgatcttattgtttttgcaccatat
cgttcagttgaaggttttgttgatgacatggaggagttctgccaagcaaaaaatgaccgg
cttcaaatgttgaaggatttgcacaaaactgcaaagatggaagtagacaagaccatgctc
acagatgcgccacttctattccctcctggccagttggcattggctgctttgcggaggtca
aatgaggtgcaccaagttcttgacttcgagagatatctgagcagcatcctctctcgacag
gatttttcacacgccttctcagagctcactgaatctctaaacgcaatagattcttgggta
atgaaacatcaagtccctaccactgaagacatgaagcatattgatcgaaaactgaaattt
tgtttggatcctagctcacatgacaagagtaagaaaagggagaagaaatcgaagcacaaa
tccaaaagaagtgcaagtgaaatgcaaaacttacctcctggtgcttaa

DBGET integrated database retrieval system