KEGG   Vitis vinifera (wine grape): 100252789Help
Entry
100252789         CDS       T01084                                 

Definition
(RefSeq) cyclin-H1-1
  KO
K06634  cyclin H
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi03022  Basal transcription factors
vvi03420  Nucleotide excision repair
Module
vvi_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100252789
  Replication and repair
   03420 Nucleotide excision repair
    100252789
Transcription machinery [BR:vvi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100252789
DNA repair and recombination proteins [BR:vvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100252789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C_2 TFIIB RB_B
Motif
Other DBs
NCBI-GeneID: 100252789
NCBI-ProteinID: XP_002284178
UniProt: D7U9R4
Position
14
AA seq 335 aa AA seqDB search
MADFQTSTHRSKWIFTPQDLIEKYKAANQRAKQTLEKYGVTRIEVDADGSLQYPEPQISA
KDNAEKRSRPKPLNFEEERFMRSFYEYKIQEVCAAFSFPHKIQATALIYYKRFYLQWSVM
EHHPKHIMLTCIYAACKIEENHVSAEELGKGIAQDHQMILNNEMIVLQSLDFDLIVFAPY
RSVEGFVDDMEEFCQAKNDRLQMLKDLHKTAKMEVDKTMLTDAPLLFPPGQLALAALRRS
NEVHQVLDFERYLSSILSRQDFSHAFSELTESLNAIDSWVMKHQVPTTEDMKHIDRKLKF
CLDPSSHDKSKKREKKSKHKSKRSASEMQNLPPGA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggccgatttccaaacctccactcaccgatctaagtggatcttcactcctcaagacctg
attgaaaagtacaaagctgccaatcagagagcaaaacaaacattggagaagtatggagta
acacgcattgaagtagatgctgatgggtcattgcaataccctgaacctcaaattagtgca
aaagacaatgctgaaaagcgttctcgacccaaaccacttaattttgaagaagaacgattt
atgcggtcattctatgagtataagattcaagaagtatgtgcagccttctctttccctcac
aaaattcaggcaacagctctcatatactacaaaaggttttatctgcagtggtcggtcatg
gaacatcacccaaaacacataatgttaacctgcatatatgcagcttgtaagatagaagaa
aaccatgtatcagcggaggagctcggtaaggggattgcacaagatcaccaaatgattctc
aataatgagatgatagttcttcagagtctagattttgatcttattgtttttgcaccatat
cgttcagttgaaggttttgttgatgacatggaggagttctgccaagcaaaaaatgaccgg
cttcaaatgttgaaggatttgcacaaaactgcaaagatggaagtagacaagaccatgctc
acagatgcgccacttctattccctcctggccagttggcattggctgctttgcggaggtca
aatgaggtgcaccaagttcttgacttcgagagatatctgagcagcatcctctctcgacag
gatttttcacacgccttctcagagctcactgaatctctaaacgcaatagattcttgggta
atgaaacatcaagtccctaccactgaagacatgaagcatattgatcgaaaactgaaattt
tgtttggatcctagctcacatgacaagagtaagaaaagggagaagaaatcgaagcacaaa
tccaaaagaagtgcaagtgaaatgcaaaacttacctcctggtgcttaa

DBGET integrated database retrieval system