KEGG   Vitis vinifera (wine grape): 100252806Help
Entry
100252806         CDS       T01084                                 

Definition
histone acetyltransferase GCN5-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 541 aa AA seqDB search
MDTHSTHPTAPVRSRSSQSPSHSASASASASATSSIHKRKLTSDDHAPPFSADITSNDDL
DSISARAGGPGSDSDDDSEEDAVVDDEEDDFDNESMRTFTTARLDNSATASAAVRNTKIK
PENSTVKVESSEIGKDGGSSAAAPVGTSSVPAIVVKEDATKIFTENMQTSGTYCAREESL
KREEEAGRLKFVCLGNDGVDQHMIWLIGLKNVFARQLPNMPKEYIVRLVMDRSHKSVMVI
RRNQVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQYARDIDGLTHFLTY
ADNNAVGYFIKQGFTKEISLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQ
AIDEKIRQLSNCHIVYTGIDFQKNEVGIPRRIIKVEEIPGLKEAGWTPDQYGHSRFRTTS
ASADRASNRKSLTAFMRSLLKLMHDHPDAWPFKEPVDARDVPDYYDIIKDPMDLKTMSKR
VESEQYYITLEMFLTDVRTMFKNARTYNSPDTIYYKCATRLESFFSGKVQAGLQSSSKIQ
Q
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggacactcactctacccacccaacagccccagtacgctctcgcagctctcaatcccct
tcacactctgcctccgcctccgcttccgcctccgccacttcctcaatccacaagcgcaag
ctcacctctgacgaccacgcgccaccgttttccgccgacattacctccaatgacgatctc
gatagcatcagcgcccgcgccgggggccccggctccgattccgacgatgactccgaggag
gacgctgtcgtcgacgacgaagaggacgactttgataacgaatctatgcggacgtttacc
actgcgcggctggacaacagtgcgacggcttcagcggcagtccgtaataccaagatcaag
ccggagaattcgacggtgaaagtggaatcgtcggaaattgggaaggacggaggttcttcg
gctgcggcgccggttggaactagttctgtgccggctattgtggtgaaggaggacgccacg
aagatattcacagaaaatatgcagactagtgggacttattgcgccagagaagagagtttg
aaaagggaggaggaagcaggaaggctcaaatttgtgtgccttggaaatgatggtgttgat
cagcacatgatttggttgataggattgaagaatgtatttgccagacaactaccaaatatg
cccaaggaatacatcgttcgtcttgttatggaccgaagccacaagtctgtaatggttatc
agacgtaaccaggttgttggtggcattacataccgcccatatgtcagccaaaaatttgga
gagatagccttttgtgctatcacagctgatgagcaagtaaaaggctatggcaccagattg
atgaatcatttaaaacagtatgcacgtgatattgatgggttgactcattttctgacgtat
gctgataacaacgctgttggttattttatcaaacagggttttacaaaagaaatttccttg
gagaaagatagatggcaagggtacatcaaagattatgatggaggaatccttatggaatgc
aaaattgatccaaagcttccatacactgatctgtcaactatgattcgtcgtcagaggcag
gcaattgatgaaaagataaggcaactctcgaactgtcatattgtctacacaggaattgat
tttcagaagaatgaagttggcattccaagaaggatcatcaaagttgaggagattcctggc
ttgaaggaggctgggtggactcctgatcaatatggccattctcgatttagaacaacaagt
gcctctgcggatagagcatcgaatagaaaatccctaactgcattcatgcgctcactttta
aagttaatgcatgatcatcctgatgcttggccgttcaaggaaccagttgatgcacgtgat
gtgcctgattattatgacatcatcaaagatcctatggatttgaagacaatgtcaaagagg
gtggagtcagagcaatactatatcacattggagatgtttcttaccgatgtcaggacaatg
ttcaaaaatgcccgcacctacaactctcctgatacaatttattataaatgcgccaccagg
ctggaatcctttttctcaggaaaagttcaagcaggcctccaatctagtagcaaaattcag
cagtaa

DBGET integrated database retrieval system