KEGG   Vitis vinifera (wine grape): 100252844Help
Entry
100252844         CDS       T01084                                 

Definition
indole-3-glycerol phosphate lyase, chloroplastic-like
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100252844
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100252844
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100252844
Enzymes [BR:vvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100252844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 316 aa AA seqDB search
MAVAAFNSVSFVGLNKSEAHLLFGSGFGFPSTRLSVSFKAFKPMAAVAAVPAVGLSETFD
KLRKQGQVALIPYITAGDPDLSTTAEALKVLDSCGSDIIELGLPYSDPLADGPVIQAAAT
RSLARGTNLNAVISMLKEVVPQLSCPVALFSYYNPILKRGIGKFMTIIKDVGVHGLVVPD
VPLEETEILRMESIKNNIELVLLTTPTTPIDRMKAIVAASEGFVYLVSSVGVTGARASVS
SRVQTLLQEIKQATSKPVAVGFGISKPEHVKQVVAWGADGVIVGSAMVKVLGEAKSPEEG
LKELETFTKSLKSALL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgctgctttcaattcagtctcctttgtgggtctcaataaatccgaagcccat
cttctctttggttctggttttgggtttccttctacgaggctgtctgtttccttcaaagcc
ttcaagcccatggcggctgttgccgcagttccagcagttgggctctctgagaccttcgac
aaattgagaaaacagggccaagtggcccttatcccatacatcactgctggtgatcctgac
ctttcaactacagctgaagcgttgaaggtgcttgattcctgcgggtcagacatcattgaa
ttgggtctaccatactccgatcccttagcggatggtccagttatccaggctgctgccaca
cgctcattggcaagggggaccaatttgaatgcggtcatttcaatgttgaaggaggtggta
cctcaattatcttgcccagttgcactgttttcatattacaatccaatacttaagcgtggc
attgggaagtttatgaccatcataaaagatgttggagtgcatgggcttgtggttccagat
gttccgctagaggagactgaaatcttgagaatggaatccattaagaataacatcgaattg
gtactgctcacaacacctactactccaatagatcggatgaaagcaattgttgcagcttca
gaaggatttgtatacctagtgagttcagttggagtgactggtgcccgcgcctctgtcagt
tcacgagttcagactttgctacaagaaatcaaacaggcaacatctaagccagtggcagtt
ggctttggcatatcaaaacctgagcatgtgaaacaggtggtggcatggggagctgatggt
gtgatagttggtagtgccatggtgaaagtgctgggggaagccaaatctcccgaggaaggg
ttgaaggaactagaaactttcaccaaatccctgaagtctgcacttctttga

DBGET integrated database retrieval system