KEGG   Vitis vinifera (wine grape): 100252901Help
Entry
100252901         CDS       T01084                                 

Definition
DNA repair protein XRCC4-like
Orthology
K10886  
DNA-repair protein XRCC4
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100252901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 259 aa AA seqDB search
MEPTPRHSCLKLQIPNQSEPIFIKATWFPSHFHLSITDGLHAWLCNASEDEVRERAAQWD
QPVSDYIALAERFLGFQQPGSVYGFSDAGDGHRRLSWTFEKEGTKLEWRWKCGLSPDSRS
TTAGVLDFLMNANIRLSEEVVIKTQSFERLKVEAEKCLAQSEKFNNEKAEFESAIYAKFL
GVLNSKKAKLRELRDQISKEETTGKLPQEEDESTDKTLSFDDESDNEAIEEESSKNLTGT
SKHVSTSRPRGRKRVAPRN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggagccgacacccagacactcatgcctgaagcttcaaattcccaaccaatcggaaccc
atcttcatcaaggccacctggtttccttcccacttccacctctctatcaccgacggcctc
cacgcctggctctgtaacgcatcggaagacgaggtccgagagcgagccgcccagtgggat
caacccgtttctgattacatcgccttggcagagcggttcctagggtttcagcagcccggt
tcggtttacgggttctccgacgccggtgacggccacagaagattgtcatggacatttgag
aaggaagggactaagctagaatggcggtggaaatgtggactctcacctgactctaggagc
actaccgccggagtcctggattttcttatgaatgctaacattcgactaagtgaggaagtt
gttattaagacccaatcatttgagaggctgaaagtggaagctgaaaaatgtttagcacaa
agtgagaaattcaacaacgagaaggcggaatttgagtctgcgatctatgcaaagtttctt
ggggtcttaaattcaaagaaagccaaactcagagagcttcgagaccagatatcaaaagaa
gaaaccactggaaaattgccacaagaagaggatgagtccactgacaaaactttgagtttt
gacgatgaaagtgataatgaagcaattgaggaagaatcctcaaagaatcttacaggcact
tcaaagcatgtttctacaagtaggcctcgcggtcgaaagagagttgcacccaggaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system