KEGG   Vitis vinifera (wine grape): 100253110Help
Entry
100253110         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 3-like
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100253110
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100253110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 369 aa AA seqDB search
MGAAGSKLEKALGDQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFREQLLEYYTNNKN
LADAEENLLTCLADLFMQISSQKKKTGVIAPKRFVQRLKKQNELFRSYMHQDAHEFLNFL
LNELVDILEKEASASKSDPETSSPPEKTANGPKTAQANGVQKEPLVTWVHKNFQGILTNE
TRCLRCETVTARDETFLDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQ
KRMKIKKPPHILVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSNTVEDADSEYSLFAVV
VHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIDESSVQTFFGSAQEYSSNTDHGYILFY
ESLATNDKS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctgcaggttcgaagctcgagaaagctcttggcgatcagttccccgaaggcgag
cgatacttcgggctcgagaattttggcaacacttgctattgcaacagcgtcttgcaggct
ctttatttttgtgttccatttcgtgaacaattgctagaatattacacaaataacaaaaat
ctcgcagatgcagaagaaaatctattgacatgcttggcagacttattcatgcagataagc
tcacagaagaagaaaacaggtgttattgcaccaaagcgttttgtacagaggctgaagaaa
caaaatgagctttttcgcagctatatgcaccaggatgcacatgaatttttgaacttcttg
ctaaatgaacttgttgacatactggagaaggaggcttctgcttcaaaaagtgatccagaa
acctcatccccacctgagaagactgcaaatgggccaaagactgctcaggctaatggtgtt
cagaaagagcctctagttacctgggtgcacaaaaattttcagggtatactcacaaatgag
acaaggtgcttgcggtgtgaaacagtcacagcaagggatgaaacatttttggacttgagc
ctggatattgaacagaacagttccatcacaagctgtctgaaaaattttagctcaacagaa
actttgaatgcagaggacaaatttttctgtgacaaatgctgcagtttacaagaggcccag
aaaagaatgaagataaagaaaccacctcacatactggtcatccatttgaagcggttcaag
tacattgagcagctgggcaggtacaagaagctatcttaccgggttgttttcccgcttgag
ctgaagctgagcaatacagtagaagatgcagattctgaatattccctctttgctgtggtt
gttcatgttggaagtgggcccaaccatgggcactatgtgagccttgtgaaaagtcataac
cattggttattttttgatgatgaaaatgtggagatgattgatgagtcttccgtgcaaact
ttctttgggtctgcacaggagtattcgagtaacactgatcatgggtacatcttgttctat
gagagccttgctacaaatgacaagagctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system