KEGG   Vitis vinifera (wine grape): 100253154Help
Entry
100253154         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 25
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100253154
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100253154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 635 aa AA seqDB search
MALQMTWQPSLLHQKRKNGPPLGLKNLGNSCYLNSVLQCLTYTPPLANFCLNHLHSSLCD
SAVDRKRECPFCILEKRIVRSLSMDLTQDAPSKIQSCLRIFAEHFRLGRQEDAHEFLRYV
IDACHNTCLRLKKLRRKGNNDNGPSTTSVVKDIFGGALQSQVKCLSCGAESNKTDEIMDI
SLDVLHFNSLKQALQNFFQPEVLDGNNKYKCDNCKKLVSARKQMSILQAPNVLVIQLKRF
EGLYGGKIDKLIAFEEVLVLSSYMNKASQDSHPEYNLFATIVHSGYSPESGHYYAYIKDA
MGRWYCCNDSYVSLSTLQGVLSEKVYILFFSRTNARISPPSKAFASHNVKNRDCNGNNTS
KNPRTALPVKTRHTKQNVEHSSGMDTSTISKVDKVPSSLQIKSNSFEKTVSKRVLATGNG
KLDVHKNQILEKNGDVVEKSEKGTPSLANSNGFSINKRVDAADSVNGFVSANENDKLQNI
SGNSGKVDLYEGNVVKSRMTAEGRSNFHEVHNGGVKCPPGVSGVKRKSQDKGSCILLAQD
AHSLAKVEEFKDGLKKEASLVLRSCGWTDRLYIFMHSRKRLCAQKSGDPPSSNESKKSFI
ADAKQSFISQIPESLKEKLIERLKSFSQEKQVSGP
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcaaatgacttggcagccgagtctcctccaccagaaacgcaagaatggtcct
cctctagggttgaagaatctcggcaactcctgctatctcaacagcgtcctacagtgcttg
acatacacacctcccctcgccaatttctgcctcaatcacctccattcttcactctgcgat
tccgctgtggatcgaaaacgcgagtgccccttctgcatactggagaagcgaattgttcgg
tctttgagcatggatctcacccaggacgctccctccaagatccagagctgtctccggata
tttgcagaacactttcgattggggcggcaagaggatgcccacgagttcttgcgctatgta
attgacgcctgtcacaacacttgccttcgtctcaaaaagttgaggcgcaaggggaacaac
gataatgggccctctactactagtgtggtcaaggacatctttgggggtgctctgcagagt
caggtcaagtgtctctcttgcggggctgagtccaacaagaccgatgagattatggatata
agccttgatgtcttgcatttcaattctcttaaacaagcattacaaaactttttccagcct
gaggttttggacggtaacaacaagtacaaatgtgacaattgtaagaaattggtgtcagca
aggaagcaaatgtctattcttcaagcacccaatgtccttgtaatccagctcaagagattt
gagggcttatatggtgggaagattgataagctgattgcatttgaagaagttttggtgctc
tcgagctatatgaacaaagcaagccaggattcacatcccgagtataacctttttgctact
attgtgcattcaggctactcacctgagtcaggacactattatgcatatatcaaggatgca
atgggtcgctggtattgctgcaacgattcttatgtttcactttcaaccctgcagggggtt
ttgtcagagaaggtttacattcttttcttttctcgtactaatgcaaggatctcacccccc
agcaaagcttttgcgtcccataatgtgaagaaccgagattgcaatggcaacaatacatct
aaaaatccaaggacagctcttccagtgaaaacaaggcatacaaaacaaaatgtcgaacat
tcctctggaatggatacttccactatatctaaggttgataaggtgccttctagcctacag
attaaatcgaatagctttgaaaaaactgtttccaagagggttcttgcaactggtaatgga
aaacttgatgtgcataagaatcaaatattggaaaagaatggggatgtggtggagaaaagc
gagaaaggtacgccatctttagcaaacagcaatggttttagtataaataaaagagttgat
gctgctgatagcgtgaatggctttgtatctgcaaatgaaaatgataaacttcagaatatt
agtggtaattcgggaaaagtggatttgtatgagggtaatgttgtgaaaagcaggatgaca
gcagaaggaaggtctaacttccatgaagtgcataatggtggtgtcaaatgtccccctggt
gtttcaggggttaagagaaaatcacaggacaagggttcatgcattttacttgcacaagat
gctcattctctggcaaaagttgaagaattcaaagatggtctcaagaaggaagcttctttg
gttctgagatcttgtggttggacggataggctttatattttcatgcattcaaggaagagg
ttatgcgctcaaaaatcaggagaccctccaagcagcaatgaatcaaagaagtcatttatt
gctgatgcaaaacaatctttcatctcacaaattcctgagtcactgaaagagaagctgatt
gaacgtctaaaatcattcagccaggagaaacaagtttcaggtccttga

DBGET integrated database retrieval system