KEGG   Vitis vinifera (wine grape): 100253333Help
Entry
100253333         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 3-like
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 369 aa AA seqDB search
MGATGSKLEKALGEQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFREQLLEYYAKNKN
LGDPEENLLTCLADLFTQISSQKKKTGVIAPKRFVQRVRKQNELFRSYMHQDAHEFLNYL
LNELVDILEKESHVAKTLPDESLPSGQTANGPRNAPTNGVQREPLVTWVHKNFQGLLTNE
TRCLRCETVTARDETFLDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQ
KRMKIKKPPHILVIHLKRFKYMEQLGRHKKLSYRVVFPLELKLANSMEDVDSEYTLFAVV
VHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIDESAVQTFFGSAQEYSSNTDHGYILFY
ESLAANGKA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgactgggtcgaaactggagaaggctctgggggagcaattccctgaaggggaa
cgctactttggtctcgagaacttcggcaacacttgctattgcaacagcgttttgcaggct
ctttacttctgtgttccatttcgtgagcagttgctagaatattatgctaaaaacaagaat
ctgggggatccagaagagaatcttcttacatgtttggctgatctattcacacagataagc
tctcagaaaaagaaaacaggggtaattgctcctaaacgctttgtacaaagagtgaggaaa
caaaatgagcttttccgcagctacatgcatcaggatgcccatgaatttttgaattacttg
ttaaatgaacttgttgacatattggagaaagagtctcatgttgcaaaaactctaccagat
gagtctttaccttctggacaaactgcaaatggaccaaggaatgctccaaccaatggtgtt
caaagggagcctttagttacttgggttcacaaaaattttcagggtttattaaccaatgaa
acaaggtgcctaagatgtgaaacagtcacagcaagggatgaaacattcttagatttaagc
cttgatattgagcagaacagttcaattacaagctgcctcaaaaatttcagttctacagaa
actttaaatgctgaggataaattcttttgtgacaagtgctgcagtttgcaagaagcccag
aagaggatgaagataaagaagccacctcacatcctggttattcatctgaaacgtttcaag
tatatggagcagcttggccggcacaagaagctgtcataccgtgttgtctttcctctggag
ctcaaactagctaactccatggaggatgtggactccgagtataccttatttgctgttgtt
gttcatgtgggaagtggtcccaaccatgggcactacgtcagccttgtgaagagccacaac
cactggttgttctttgatgatgaaaatgttgagatgattgatgagtctgcagttcagact
ttcttcggatccgctcaagagtattccagtaatacggatcatggatacatactgttttat
gagagccttgctgctaatggcaaggcctga

DBGET integrated database retrieval system