KEGG   Vitis vinifera (wine grape): 100253395Help
Entry
100253395         CDS       T01084                                 

Definition
histone H2B.2-like
Orthology
K11252  
histone H2B
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 216 aa AA seqDB search
MAPKRSGKTRSKVVVKATRKVVQQTVEVTVLASKQKPPREEQGKKISKKDKAPEELQREQ
VSADEEPPKELPTPVTQEEPPKKEEEKKTTTTQEGREEKKRGRRRRRRTSGRRRKEGGEG
YKRYVYRVLKQVHPGLGVSSKAMTVLSGFMNDMFERIAEEAAKLSKYTGKTTLSAREIQG
AVKLVLPGELQKHAMAEGTKAVSNYMDYAAAGGHKQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaagcgttctggcaagactaggagtaaggtggtggtgaaggcaacccggaaa
gtggttcaacaaactgtcgaagtgacggtacttgccagcaagcaaaaaccacccagggaa
gagcaagggaagaaaatttctaaaaaggacaaagcaccagaggaattgcaaagggaacaa
gtttcagctgatgaggaaccaccgaaagagcttccgactccagtgacacaagaagaacca
ccaaaaaaggaggaagagaagaagacgacgacaacacaagaagggagagaagagaagaag
agggggaggaggaggaggaggaggacaagcggtaggagaagaaaggagggaggtgagggg
tacaagaggtacgtgtacagggtactaaagcaggtgcaccctggactgggagtatcatcg
aaggccatgactgtgctgagtggcttcatgaacgacatgttcgagagaatagcggaagaa
gcagcgaagctgtccaagtatacaggcaagacaacgctatcagcaagggagattcaaggc
gccgtcaagctggttttacctggagagctccaaaaacatgccatggctgaggggactaag
gccgtttctaattacatggactatgctgctgcaggaggccacaagcagtag

DBGET integrated database retrieval system