KEGG   Vitis vinifera (wine grape): 100253896Help
Entry
100253896         CDS       T01084                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase-like
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100253896
   00052 Galactose metabolism
    100253896
   00500 Starch and sucrose metabolism
    100253896
   00520 Amino sugar and nucleotide sugar metabolism
    100253896
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100253896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 465 aa AA seqDB search
MEKLSQLRSAVAGLDQISENEKSGFINLVSRYLSGEAQHIEWSKIKTPTDEVVVPYDTLA
PTPEDSVETKKLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGLTFLDLIVIQIENLNNK
YGCKVPLLLMNSFNTHDDTLKIVQKYEKSNIEIHTFNQSQYPRVVVDDFSPLPSKGNTGK
DGWYPPGHGDVFPALMNSGKLEKLLSQGKEYVFVANSDNLGAVVDLKILNHLIKNKNEYC
MEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVNLNAI
KRLVEADALKMEIIPNPKEVDGIKVLQLETAAGAAIRFFDNAIGINVPRSRFLPVKATSD
LLLVQSDLYTLSDGFVVRNKARKNPENPVIELGPEFKKVGNFLSRFKSIPSIIELDSLKV
AGDVWFGSGVILKGKVTIEAKAGVKLEIPNGAVVANKVINGPQDI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctctctcagctccgctctgcagtggctggtcttgatcagatcagcgagaat
gagaaatccggattcattaacctcgtctctcgctatctcagtggtgaagcgcagcacatt
gaatggagcaagatcaagactcctactgatgaagtggtggttccttatgatactttagca
cccactcctgaagattcagttgaaaccaagaagcttttggacaaacttgttgtgttaaag
ctcaatggagggttgggaacaacaatgggttgtactggtcccaaatcggtaatagaagtt
cgcaatggattgacatttcttgatttaattgtcatacagattgagaatctcaacaacaag
tatgggtgcaaagttcctctgcttctgatgaattcattcaacacacatgatgatacgctg
aagattgtacaaaaatatgagaaatcaaacattgagatccatacttttaatcagagccag
taccctcgtgtggttgttgatgactttagcccactgccgtccaaaggaaatactggaaaa
gatgggtggtaccctcctgggcatggtgatgtgttcccagccttgatgaacagtggcaag
cttgaaaaattattgtcacagggcaaggagtatgtctttgtcgccaattcagataacttg
ggtgctgtggttgacctgaaaatcttaaatcatttgatcaaaaacaagaacgaatactgt
atggaggtgacacccaaaaccttggctgatgtgaagggtggtaccctcatttcttatgaa
gggaaggttcagctcctggaaattgcacaggtcccagatgaacatgtcaatgaattcaag
tcaatagagaagttcaaaattttcaatacaaacaatttgtgggtgaacttgaatgcaatt
aagaggcttgtggaggctgatgcacttaagatggagattattccaaaccccaaggaagtg
gatggtatcaaagttcttcagttggaaaccgcggctggtgcagcaattaggttcttcgat
aatgctattggtatcaatgttccccgctcccgttttcttcctgtgaaggcaacttcggat
ttgcttcttgtccagtctgatctttacaccttatctgatggatttgttgtccgaaacaaa
gctagaaagaatcctgaaaatcctgttattgagttggggcctgaatttaagaaggttggc
aacttcttgagtcgattcaagtcaatccctagtatcattgagctggatagtcttaaggta
gctggtgatgtatggtttgggtctggtgttattctcaaggggaaggtgactattgaagct
aaggctggggtgaaattggaaatacccaatggagctgtagttgcaaacaaggtgatcaat
ggtcctcaggacatctaa

DBGET integrated database retrieval system