KEGG   Vitis vinifera (wine grape): 100253952Help
Entry
100253952         CDS       T01084                                 

Definition
choline/ethanolamine kinase-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100253952
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100253952
    2.7.1.82  ethanolamine kinase
     100253952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 363 aa AA seqDB search
MGAVEDRVNNKAGRLPGEARRILLSLASSWDNVTDSNALQVIPLKGAMTNEVYQIKWPTS
TGETSRKVLVRIYGEGVEVFFDRASEIQTFEFISKHGQGPRLLGRFPNGRIEEFIHARTL
SAADLHDPDISDLIAIKMKEFHDLNMPGPKDVVLWDRMRDWLSAAKNLSSPEEANTFQLD
AIEEEISLLEKKLPGNHLHIGFCHNDLQYGNIMIDEETSLITIIDYEYASYNPVTYDIAN
HFCEMAADYHTETPHILDYSKYPSLEKRQRFLRIYLGHAGDQPNDLELEVLVQDVEKYTL
ASHLLWGLWGIISEHVNEIDFNYMEYARQRFEQYWLRKPELLGSSGPASDGTTGDLFKNS
GNS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgtagaagatagagtaaacaacaaagcaggccgtttaccaggggaagcaagg
agaattctcctatcattggcttctagctgggacaatgtaactgattcaaatgcattgcag
gtcatcccacttaaaggtgcaatgaccaatgaggtctaccaaatcaagtggcctacaagc
acaggggaaacctcacggaaagttctggttagaatctatggtgagggtgtggaagttttc
tttgaccgagccagcgagatccagacatttgagtttatttcgaagcatgggcagggtcct
cggctattagggcgatttccaaatggccgaattgaagagttcattcatgcaaggacacta
tcagcagctgatctgcatgacccagatatatctgatcttattgcaatcaaaatgaaagag
ttccatgatcttaatatgcctggtccaaaggatgttgtcctttgggatagaatgcgagat
tggctcagtgcagccaaaaacttgtcatccccagaagaagctaacacatttcagttggat
gctattgaggaggaaatctctttattggagaagaagcttcctggaaatcatctacatata
ggattttgccacaatgatttacaatatggtaacataatgatcgatgaagagactagctta
attacaataattgattatgagtatgcaagttacaatcctgtcacttatgacatagcaaat
cacttctgtgagatggctgctgactatcatacagaaacgcctcacattttggactacagc
aaataccccagtttggagaagcggcagagatttttgcgcatatatctgggccatgcaggt
gatcaacctaatgaccttgaactggaggtgctagttcaagatgtcgagaagtataccctt
gcaagccatcttctctggggcttatggggaataatatcagaacatgtaaatgaaattgat
ttcaactacatggaatatgcaaggcagaggtttgaacaatattggttaaggaagcctgag
ctcttgggttcttctggacctgcttctgacggtaccaccggtgatttgttcaagaattca
gggaattcatga

DBGET integrated database retrieval system