KEGG   Vitis vinifera (wine grape): 100253952Help
Entry
100253952         CDS       T01084                                 

Definition
choline/ethanolamine kinase-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:vvi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 363 aa AA seqDB search
MGAVEDRVNNKAGRLPGEARRILLSLASSWDNVTDSNALQVIPLKGAMTNEVYQIKWPTS
TGETSRKVLVRIYGEGVEVFFDRASEIQTFEFISKHGQGPRLLGRFPNGRIEEFIHARTL
SAADLHDPDISDLIAIKMKEFHDLNMPGPKDVVLWDRMRDWLSAAKNLSSPEEANTFQLD
AIEEEISLLEKKLPGNHLHIGFCHNDLQYGNIMIDEETSLITIIDYEYASYNPVTYDIAN
HFCEMAADYHTETPHILDYSKYPSLEKRQRFLRIYLGHAGDQPNDLELEVLVQDVEKYTL
ASHLLWGLWGIISEHVNEIDFNYMEYARQRFEQYWLRKPELLGSSGPASDGTTGDLFKNS
GNS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgtagaagatagagtaaacaacaaagcaggccgtttaccaggggaagcaagg
agaattctcctatcattggcttctagctgggacaatgtaactgattcaaatgcattgcag
gtcatcccacttaaaggtgcaatgaccaatgaggtctaccaaatcaagtggcctacaagc
acaggggaaacctcacggaaagttctggttagaatctatggtgagggtgtggaagttttc
tttgaccgagccagcgagatccagacatttgagtttatttcgaagcatgggcagggtcct
cggctattagggcgatttccaaatggccgaattgaagagttcattcatgcaaggacacta
tcagcagctgatctgcatgacccagatatatctgatcttattgcaatcaaaatgaaagag
ttccatgatcttaatatgcctggtccaaaggatgttgtcctttgggatagaatgcgagat
tggctcagtgcagccaaaaacttgtcatccccagaagaagctaacacatttcagttggat
gctattgaggaggaaatctctttattggagaagaagcttcctggaaatcatctacatata
ggattttgccacaatgatttacaatatggtaacataatgatcgatgaagagactagctta
attacaataattgattatgagtatgcaagttacaatcctgtcacttatgacatagcaaat
cacttctgtgagatggctgctgactatcatacagaaacgcctcacattttggactacagc
aaataccccagtttggagaagcggcagagatttttgcgcatatatctgggccatgcaggt
gatcaacctaatgaccttgaactggaggtgctagttcaagatgtcgagaagtataccctt
gcaagccatcttctctggggcttatggggaataatatcagaacatgtaaatgaaattgat
ttcaactacatggaatatgcaaggcagaggtttgaacaatattggttaaggaagcctgag
ctcttgggttcttctggacctgcttctgacggtaccaccggtgatttgttcaagaattca
gggaattcatga

DBGET integrated database retrieval system