KEGG   Vitis vinifera (wine grape): 100254058Help
Entry
100254058         CDS       T01084                                 

Definition
(R)-mandelonitrile lyase-like
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    100254058
Enzymes [BR:vvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     100254058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 548 aa AA seqDB search
MAKPMSSSPSFLALLIVFSLHHLSRGQFPQGPSYSKFVVNATEMPPEDYYDYIVVGGGTA
GCPLAATLSENFRVLVLERGGVPYTNPNLMSQDGFLTSLMEADPYDSPAQTFTSEDGVAN
ARGRVLGGSSAINAGFYSRADEDFYKKSGLKWDLHIVNQSYEWVERAVVFRPELKNWQSA
VRDGLLEAGVDPYRGFILDHAVGTKIGGSTFDSSGRRHTAADLLGYAKATNIRVAVHASV
ERILLAPTSALSGSKQSAIGVVYRDRIGRYHHAMVRENGEVILSAGAIGTPQLLLLSGIG
PRSYLSSWGIPVVHHLPYVGQFLYDNPRNGISIVSPIPLEHSLIQVVGITNLGAYIEAAS
NVIPFASPARSVFIRTPSSPLYLTVATLMEKIIGPLSSGSLQLASTDIKVNPLVRFNYFA
DPLDLERCVSGMRKVGDVLRSRSMEEFKFREWFGGQDFRFVGPALPVNQSNDAQMAEFCH
RTVSTIWHYHGGCIVGKVVDSDHQVLGIDALRVVDGSTFNVSPGTNPQATLMMLGRYIGI
KITKERMR
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacccatgtcgtcttctccttcatttcttgctttactcatcgtttttagcctc
caccacctctctcgaggacagtttccacaaggtccaagctactctaaatttgtagttaat
gctacggagatgccgccggaagattactatgactacatcgtcgtcggcgggggaactgcc
gggtgcccattggcggcgacgctgtcggagaattttcgagtattggttctggaacgtggt
ggtgtgccttacaccaatcccaatctgatgagccaagatggtttcttaacctctctcatg
gaggccgacccctacgactcccctgctcaaacattcacgtccgaagatggcgtagccaac
gccagaggccgggttctcggcggcagtagcgcaatcaacgccggcttctacagcagagct
gacgaagatttctataaaaaatcagggctgaaatgggacctccacattgtcaatcagtcg
tatgagtgggtggagagggcggtggtctttaggccggagctcaagaactggcaatcagca
gttcgggacgggttgttagaggctggtgttgatccatacaggggtttcattcttgatcat
gccgtgggaaccaagattggtggctccacttttgatagttccggcaggcggcacactgcc
gctgaccttcttggctatgccaaagccaccaacatcagagtggcagtccacgccagtgtt
gaaagaatcctccttgcccctacttcagccctgtctgggtcgaagcagtctgcaatcggg
gtggtgtatcgtgatagaatagggcggtaccaccatgcaatggttcgggaaaatggagag
gtgatactgagtgctggggccattgggactcctcagctgctgctcttgagcggcattggg
ccaaggtcgtatctctcttcgtggggaattccggtggtgcatcatttgccttatgtgggg
cagttcctctatgataacccccgaaatggtatttcaattgtttccccaattcccctcgag
cattcattgatacaagtagtgggaataactaatttaggggcttatattgaagcagcttcc
aatgtcataccttttgcatctcctgcccgctctgttttcattcggacaccttcttctccc
ctctatctcactgtggccaccctcatggagaagataattgggccactctcgagtggttct
cttcaactcgcatccacagatatcaaggtgaacccacttgtcaggtttaactattttgct
gatccacttgacttggaacgatgtgtaagtggcatgcgcaaggttggggatgtcttgagg
agtcgttcaatggaggagttcaagttcagggagtggtttgggggtcaagatttcaggttt
gttggacctgcattgcctgttaaccaatccaatgatgctcagatggctgagttctgccat
cgaacagtgagcacgatatggcattatcatggaggctgcattgtgggtaaggtggttgat
agtgatcaccaggtccttggcattgatgctcttagagttgtcgatggttcaactttcaat
gtgtcaccaggcactaatcctcaggctactttaatgatgctcggacggtatattgggata
aaaataaccaaagagcgaatgagatag

DBGET integrated database retrieval system